BLASTX nr result
ID: Paeonia23_contig00017316
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00017316 (298 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003634359.1| PREDICTED: probable calcium-binding protein ... 59 9e-07 emb|CAN78405.1| hypothetical protein VITISV_023174 [Vitis vinifera] 59 9e-07 emb|CAN63002.1| hypothetical protein VITISV_004362 [Vitis vinifera] 58 1e-06 ref|XP_006434792.1| hypothetical protein CICLE_v10002898mg [Citr... 57 3e-06 ref|XP_004238583.1| PREDICTED: calmodulin-like protein 4-like [S... 56 5e-06 >ref|XP_003634359.1| PREDICTED: probable calcium-binding protein CML10-like [Vitis vinifera] Length = 91 Score = 58.5 bits (140), Expect = 9e-07 Identities = 29/52 (55%), Positives = 35/52 (67%) Frame = -1 Query: 286 ELKNVFKQLGSWFPGWRAAEAINIADRDGDGEISEAEMHRVVKYAFDNGYKI 131 ELK F+ LG+ PGWRA A++ AD DGDG ISE EM +V+YA GY I Sbjct: 39 ELKQAFQHLGALIPGWRAHRALHHADADGDGCISEKEMKDLVEYAAKFGYTI 90 >emb|CAN78405.1| hypothetical protein VITISV_023174 [Vitis vinifera] Length = 91 Score = 58.5 bits (140), Expect = 9e-07 Identities = 29/52 (55%), Positives = 35/52 (67%) Frame = -1 Query: 286 ELKNVFKQLGSWFPGWRAAEAINIADRDGDGEISEAEMHRVVKYAFDNGYKI 131 ELK F+ LG+ PGWRA A++ AD DGDG ISE EM +V+YA GY I Sbjct: 39 ELKQAFQHLGALIPGWRAHRALHHADTDGDGCISEKEMKDLVEYAAKFGYTI 90 >emb|CAN63002.1| hypothetical protein VITISV_004362 [Vitis vinifera] Length = 89 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/52 (53%), Positives = 34/52 (65%) Frame = -1 Query: 286 ELKNVFKQLGSWFPGWRAAEAINIADRDGDGEISEAEMHRVVKYAFDNGYKI 131 ELK FK LGS FP WRA A++ AD + DG ISE E+ +V YA GYK+ Sbjct: 38 ELKEAFKHLGSHFPXWRAXRALSRADANKDGYISEEELTSLVNYALKFGYKV 89 >ref|XP_006434792.1| hypothetical protein CICLE_v10002898mg [Citrus clementina] gi|557536914|gb|ESR48032.1| hypothetical protein CICLE_v10002898mg [Citrus clementina] Length = 112 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/52 (50%), Positives = 34/52 (65%) Frame = -1 Query: 286 ELKNVFKQLGSWFPGWRAAEAINIADRDGDGEISEAEMHRVVKYAFDNGYKI 131 EL++ FK LGS FP WRA A+ AD +GDG I+E E+ +VKY GY + Sbjct: 60 ELQDAFKSLGSTFPAWRAWRALRHADANGDGCINEDELRELVKYVIKRGYAL 111 >ref|XP_004238583.1| PREDICTED: calmodulin-like protein 4-like [Solanum lycopersicum] Length = 129 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/52 (46%), Positives = 38/52 (73%) Frame = -1 Query: 286 ELKNVFKQLGSWFPGWRAAEAINIADRDGDGEISEAEMHRVVKYAFDNGYKI 131 +L F+QLGS FPG+RA A++ AD++GDG I + E+ ++V+YA GY++ Sbjct: 72 DLTEAFRQLGSTFPGYRAGRALHRADKNGDGLIDKKELDKLVEYARKRGYRL 123