BLASTX nr result
ID: Paeonia23_contig00017126
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00017126 (316 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006655070.1| PREDICTED: ABC transporter C family member 8... 56 6e-06 >ref|XP_006655070.1| PREDICTED: ABC transporter C family member 8-like [Oryza brachyantha] Length = 1358 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = -1 Query: 109 ASPRIKDCGMASLENKTVILVTHQVEFLSEVDKLMV 2 A+ DC MA+LENKTVILVTHQVEFLS+VDK++V Sbjct: 663 AATLFNDCAMAALENKTVILVTHQVEFLSKVDKILV 698