BLASTX nr result
ID: Paeonia23_contig00012978
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00012978 (622 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002516708.1| transcription factor, putative [Ricinus comm... 56 1e-05 >ref|XP_002516708.1| transcription factor, putative [Ricinus communis] gi|223544203|gb|EEF45727.1| transcription factor, putative [Ricinus communis] Length = 451 Score = 55.8 bits (133), Expect = 1e-05 Identities = 24/36 (66%), Positives = 29/36 (80%) Frame = -1 Query: 142 GNLPLTYTGILPTKRFLKSYRCDGYRIKDENGGVVI 35 GN+PL+Y G+L +R L+ Y CDGYRIKDENG VVI Sbjct: 399 GNVPLSYCGLLQARRLLQGYGCDGYRIKDENGCVVI 434