BLASTX nr result
ID: Paeonia23_contig00012806
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00012806 (312 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPT00482.1| hypothetical protein FOMPIDRAFT_1023676 [Fomitops... 59 9e-07 ref|XP_007360071.1| hypothetical protein DICSQDRAFT_94979 [Dicho... 57 3e-06 gb|EMD32389.1| hypothetical protein CERSUDRAFT_118748 [Ceriporio... 56 6e-06 >gb|EPT00482.1| hypothetical protein FOMPIDRAFT_1023676 [Fomitopsis pinicola FP-58527 SS1] Length = 193 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/36 (75%), Positives = 31/36 (86%) Frame = -2 Query: 113 CTRQYVVVDGDTCDAISAKQNVSTFQLAAVNPEIDA 6 C+RQY V GD CD+ISA+QNVST+QLAAVNP IDA Sbjct: 24 CSRQYTVKAGDICDSISAQQNVSTYQLAAVNPGIDA 59 >ref|XP_007360071.1| hypothetical protein DICSQDRAFT_94979 [Dichomitus squalens LYAD-421 SS1] gi|395334144|gb|EJF66520.1| hypothetical protein DICSQDRAFT_94979 [Dichomitus squalens LYAD-421 SS1] Length = 215 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/35 (71%), Positives = 29/35 (82%) Frame = -2 Query: 113 CTRQYVVVDGDTCDAISAKQNVSTFQLAAVNPEID 9 CTR Y V +GD CD ISA+ NVST+QLAAVNP+ID Sbjct: 24 CTRTYTVKEGDWCDTISAQHNVSTYQLAAVNPDID 58 >gb|EMD32389.1| hypothetical protein CERSUDRAFT_118748 [Ceriporiopsis subvermispora B] Length = 192 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/36 (69%), Positives = 27/36 (75%) Frame = -2 Query: 113 CTRQYVVVDGDTCDAISAKQNVSTFQLAAVNPEIDA 6 CTR Y V DGD CD ISA NVST+QLA VNP ID+ Sbjct: 25 CTRTYTVQDGDICDGISAAHNVSTYQLAVVNPSIDS 60