BLASTX nr result
ID: Paeonia23_contig00012778
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00012778 (369 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002523161.1| ATP binding protein, putative [Ricinus commu... 73 4e-11 emb|CBI22665.3| unnamed protein product [Vitis vinifera] 71 2e-10 ref|XP_002272986.1| PREDICTED: probable receptor-like protein ki... 71 2e-10 ref|XP_002305911.2| hypothetical protein POPTR_0004s07780g [Popu... 70 3e-10 ref|XP_006372441.1| kinase family protein [Populus trichocarpa] ... 69 9e-10 ref|XP_006388821.1| hypothetical protein POPTR_0096s00220g, part... 69 9e-10 ref|XP_003606802.1| Kinase-like protein [Medicago truncatula] gi... 69 9e-10 ref|XP_003592208.1| Pto disease resistance protein [Medicago tru... 68 1e-09 ref|XP_007152195.1| hypothetical protein PHAVU_004G109500g [Phas... 67 3e-09 ref|XP_007219225.1| hypothetical protein PRUPE_ppa017272mg [Prun... 65 1e-08 ref|XP_004157220.1| PREDICTED: probable receptor-like protein ki... 65 1e-08 ref|XP_004140755.1| PREDICTED: probable receptor-like protein ki... 65 1e-08 ref|XP_007143463.1| hypothetical protein PHAVU_007G074000g [Phas... 65 1e-08 ref|XP_004496832.1| PREDICTED: probable receptor-like protein ki... 64 2e-08 ref|XP_004234787.1| PREDICTED: probable receptor-like protein ki... 64 2e-08 ref|XP_006342301.1| PREDICTED: probable receptor-like protein ki... 64 3e-08 ref|XP_003535601.1| PREDICTED: probable receptor-like protein ki... 64 3e-08 ref|XP_007038795.1| Kinase superfamily protein [Theobroma cacao]... 61 1e-07 ref|NP_197789.1| putative receptor-like protein kinase [Arabidop... 61 2e-07 gb|EYU19577.1| hypothetical protein MIMGU_mgv1a020464mg [Mimulus... 60 2e-07 >ref|XP_002523161.1| ATP binding protein, putative [Ricinus communis] gi|223537568|gb|EEF39192.1| ATP binding protein, putative [Ricinus communis] Length = 831 Score = 73.2 bits (178), Expect = 4e-11 Identities = 33/57 (57%), Positives = 42/57 (73%) Frame = +2 Query: 194 ISATTWSITLTNTNPSPNLSTLYHMARVFTGALSYNFKIEKIGTHFIRIHLSPFKSQ 364 + +T SI+LTN NPSPNL +L+H ARVFT + SY F I+K GTH +R H SPF +Q Sbjct: 58 VLSTAQSISLTNQNPSPNLPSLHHTARVFTSSSSYKFNIKKNGTHLLRFHFSPFAAQ 114 >emb|CBI22665.3| unnamed protein product [Vitis vinifera] Length = 258 Score = 70.9 bits (172), Expect = 2e-10 Identities = 31/51 (60%), Positives = 39/51 (76%) Frame = +2 Query: 212 SITLTNTNPSPNLSTLYHMARVFTGALSYNFKIEKIGTHFIRIHLSPFKSQ 364 SI+LT++NPSP S LYH ARVFTGA Y F+I++ GTHF+R H PF S+ Sbjct: 12 SISLTDSNPSPGSSNLYHTARVFTGASRYEFRIQQAGTHFVRFHFWPFNSR 62 >ref|XP_002272986.1| PREDICTED: probable receptor-like protein kinase At5g24010 [Vitis vinifera] Length = 822 Score = 70.9 bits (172), Expect = 2e-10 Identities = 31/51 (60%), Positives = 39/51 (76%) Frame = +2 Query: 212 SITLTNTNPSPNLSTLYHMARVFTGALSYNFKIEKIGTHFIRIHLSPFKSQ 364 SI+LT++NPSP S LYH ARVFTGA Y F+I++ GTHF+R H PF S+ Sbjct: 59 SISLTDSNPSPGSSNLYHTARVFTGASRYEFRIQQAGTHFVRFHFWPFNSR 109 >ref|XP_002305911.2| hypothetical protein POPTR_0004s07780g [Populus trichocarpa] gi|550340559|gb|EEE86422.2| hypothetical protein POPTR_0004s07780g [Populus trichocarpa] Length = 827 Score = 70.1 bits (170), Expect = 3e-10 Identities = 33/51 (64%), Positives = 39/51 (76%) Frame = +2 Query: 212 SITLTNTNPSPNLSTLYHMARVFTGALSYNFKIEKIGTHFIRIHLSPFKSQ 364 SI+ N NPSPN TLY+ ARVFT A SY F I++ GTHFIR+H SPFK+Q Sbjct: 66 SISPKNQNPSPNSPTLYNTARVFTTASSYKFSIKRNGTHFIRLHFSPFKAQ 116 >ref|XP_006372441.1| kinase family protein [Populus trichocarpa] gi|550319065|gb|ERP50238.1| kinase family protein [Populus trichocarpa] Length = 826 Score = 68.6 bits (166), Expect = 9e-10 Identities = 32/51 (62%), Positives = 37/51 (72%) Frame = +2 Query: 212 SITLTNTNPSPNLSTLYHMARVFTGALSYNFKIEKIGTHFIRIHLSPFKSQ 364 SI+L N NPSPN TLY ARVFT A SY F I++ GTH +R H SPFK+Q Sbjct: 66 SISLKNQNPSPNSPTLYSTARVFTTASSYQFNIKRNGTHLVRFHFSPFKAQ 116 >ref|XP_006388821.1| hypothetical protein POPTR_0096s00220g, partial [Populus trichocarpa] gi|550310870|gb|ERP47735.1| hypothetical protein POPTR_0096s00220g, partial [Populus trichocarpa] Length = 454 Score = 68.6 bits (166), Expect = 9e-10 Identities = 32/51 (62%), Positives = 37/51 (72%) Frame = +2 Query: 212 SITLTNTNPSPNLSTLYHMARVFTGALSYNFKIEKIGTHFIRIHLSPFKSQ 364 SI+L N NPSPN TLY ARVFT A SY F I++ GTH +R H SPFK+Q Sbjct: 66 SISLKNQNPSPNSPTLYSTARVFTTASSYQFNIKRNGTHLVRFHFSPFKAQ 116 >ref|XP_003606802.1| Kinase-like protein [Medicago truncatula] gi|355507857|gb|AES88999.1| Kinase-like protein [Medicago truncatula] Length = 794 Score = 68.6 bits (166), Expect = 9e-10 Identities = 31/51 (60%), Positives = 39/51 (76%) Frame = +2 Query: 212 SITLTNTNPSPNLSTLYHMARVFTGALSYNFKIEKIGTHFIRIHLSPFKSQ 364 SI+LTN NPSPNL+TLYH AR+FT SY F +++ GT F+R H S FK+Q Sbjct: 64 SISLTNQNPSPNLATLYHTARIFTSKGSYRFTLKQNGTFFVRFHFSCFKAQ 114 >ref|XP_003592208.1| Pto disease resistance protein [Medicago truncatula] gi|355481256|gb|AES62459.1| Pto disease resistance protein [Medicago truncatula] Length = 814 Score = 68.2 bits (165), Expect = 1e-09 Identities = 32/51 (62%), Positives = 35/51 (68%) Frame = +2 Query: 212 SITLTNTNPSPNLSTLYHMARVFTGALSYNFKIEKIGTHFIRIHLSPFKSQ 364 SI+LTN NPSPNL TLYH ARVF Y F ++K GTH IR H PFK Q Sbjct: 78 SISLTNKNPSPNLQTLYHTARVFITTGRYRFNMKKNGTHLIRFHFFPFKDQ 128 >ref|XP_007152195.1| hypothetical protein PHAVU_004G109500g [Phaseolus vulgaris] gi|561025504|gb|ESW24189.1| hypothetical protein PHAVU_004G109500g [Phaseolus vulgaris] Length = 834 Score = 66.6 bits (161), Expect = 3e-09 Identities = 30/51 (58%), Positives = 36/51 (70%) Frame = +2 Query: 212 SITLTNTNPSPNLSTLYHMARVFTGALSYNFKIEKIGTHFIRIHLSPFKSQ 364 SI+LTN NP P+L LYH ARVF SY F ++K GTH +R H SPFK+Q Sbjct: 62 SISLTNQNPPPDLPILYHTARVFPSTGSYRFNMKKHGTHLVRFHFSPFKAQ 112 >ref|XP_007219225.1| hypothetical protein PRUPE_ppa017272mg [Prunus persica] gi|462415687|gb|EMJ20424.1| hypothetical protein PRUPE_ppa017272mg [Prunus persica] Length = 820 Score = 65.1 bits (157), Expect = 1e-08 Identities = 30/51 (58%), Positives = 35/51 (68%) Frame = +2 Query: 212 SITLTNTNPSPNLSTLYHMARVFTGALSYNFKIEKIGTHFIRIHLSPFKSQ 364 SI+LTN NP PN LYH ARVF SY+F I+K GTH +R H SPF +Q Sbjct: 57 SISLTNQNPPPNSPALYHTARVFKRISSYSFGIKKYGTHMVRFHFSPFVAQ 107 >ref|XP_004157220.1| PREDICTED: probable receptor-like protein kinase At5g24010-like, partial [Cucumis sativus] Length = 831 Score = 65.1 bits (157), Expect = 1e-08 Identities = 29/50 (58%), Positives = 36/50 (72%) Frame = +2 Query: 212 SITLTNTNPSPNLSTLYHMARVFTGALSYNFKIEKIGTHFIRIHLSPFKS 361 S+ L++ NP P+ +LYH ARVFT SY F I+K GTHF+R HLSPF S Sbjct: 67 SVALSDRNPPPDSPSLYHTARVFTRVSSYKFNIKKNGTHFLRFHLSPFSS 116 >ref|XP_004140755.1| PREDICTED: probable receptor-like protein kinase At5g24010-like [Cucumis sativus] Length = 827 Score = 65.1 bits (157), Expect = 1e-08 Identities = 29/50 (58%), Positives = 36/50 (72%) Frame = +2 Query: 212 SITLTNTNPSPNLSTLYHMARVFTGALSYNFKIEKIGTHFIRIHLSPFKS 361 S+ L++ NP P+ +LYH ARVFT SY F I+K GTHF+R HLSPF S Sbjct: 63 SVALSDRNPPPDSPSLYHTARVFTRVSSYKFNIKKNGTHFLRFHLSPFSS 112 >ref|XP_007143463.1| hypothetical protein PHAVU_007G074000g [Phaseolus vulgaris] gi|593682173|ref|XP_007143464.1| hypothetical protein PHAVU_007G074000g [Phaseolus vulgaris] gi|561016653|gb|ESW15457.1| hypothetical protein PHAVU_007G074000g [Phaseolus vulgaris] gi|561016654|gb|ESW15458.1| hypothetical protein PHAVU_007G074000g [Phaseolus vulgaris] Length = 844 Score = 64.7 bits (156), Expect = 1e-08 Identities = 28/51 (54%), Positives = 35/51 (68%) Frame = +2 Query: 212 SITLTNTNPSPNLSTLYHMARVFTGALSYNFKIEKIGTHFIRIHLSPFKSQ 364 S++L P PNL TLYH ARVF+ Y F ++K GTHF+R H SPFK+Q Sbjct: 82 SVSLAYQKPPPNLPTLYHTARVFSSTGGYRFNMKKNGTHFVRFHFSPFKAQ 132 >ref|XP_004496832.1| PREDICTED: probable receptor-like protein kinase At5g24010-like, partial [Cicer arietinum] Length = 898 Score = 64.3 bits (155), Expect = 2e-08 Identities = 29/51 (56%), Positives = 35/51 (68%) Frame = +2 Query: 212 SITLTNTNPSPNLSTLYHMARVFTGALSYNFKIEKIGTHFIRIHLSPFKSQ 364 SI+L N NPSPN TLYH ARVFT Y F +++ GTH +R H PFK+Q Sbjct: 136 SISLINKNPSPNFPTLYHTARVFTSNGRYRFHMKENGTHLVRFHFFPFKAQ 186 >ref|XP_004234787.1| PREDICTED: probable receptor-like protein kinase At5g24010-like [Solanum lycopersicum] Length = 818 Score = 63.9 bits (154), Expect = 2e-08 Identities = 30/46 (65%), Positives = 34/46 (73%) Frame = +2 Query: 227 NTNPSPNLSTLYHMARVFTGALSYNFKIEKIGTHFIRIHLSPFKSQ 364 NTNPS NLS LY ARVF+ A Y F I KIGTHF+R+H SPF S+ Sbjct: 67 NTNPSSNLSFLYTSARVFSDASKYVFNINKIGTHFLRLHFSPFTSR 112 >ref|XP_006342301.1| PREDICTED: probable receptor-like protein kinase At5g24010-like [Solanum tuberosum] Length = 818 Score = 63.5 bits (153), Expect = 3e-08 Identities = 30/45 (66%), Positives = 32/45 (71%) Frame = +2 Query: 227 NTNPSPNLSTLYHMARVFTGALSYNFKIEKIGTHFIRIHLSPFKS 361 NTNPS NLS LY ARVF A Y F I KIGTHF+R+H SPF S Sbjct: 67 NTNPSSNLSFLYSSARVFNDASKYVFNINKIGTHFLRLHFSPFTS 111 >ref|XP_003535601.1| PREDICTED: probable receptor-like protein kinase At5g24010-like [Glycine max] Length = 826 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/51 (56%), Positives = 34/51 (66%) Frame = +2 Query: 212 SITLTNTNPSPNLSTLYHMARVFTGALSYNFKIEKIGTHFIRIHLSPFKSQ 364 SI+LT P NLSTLYH ARVF Y F ++K GTH +R H SPFK+Q Sbjct: 62 SISLTYQKPPQNLSTLYHTARVFRSTARYRFNMKKNGTHLVRFHFSPFKAQ 112 >ref|XP_007038795.1| Kinase superfamily protein [Theobroma cacao] gi|508776040|gb|EOY23296.1| Kinase superfamily protein [Theobroma cacao] Length = 848 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/53 (54%), Positives = 38/53 (71%), Gaps = 2/53 (3%) Frame = +2 Query: 212 SITLTNTNPSPNLSTLYHMARVFTGALSYNFKIEKIGT--HFIRIHLSPFKSQ 364 S++LT+ +PSPN LYH ARVFT SY F I+K GT H +R+H SPF++Q Sbjct: 84 SVSLTDRSPSPNTPILYHTARVFTTDSSYKFNIKKNGTGIHLVRLHFSPFQAQ 136 >ref|NP_197789.1| putative receptor-like protein kinase [Arabidopsis thaliana] gi|75334039|sp|Q9FLW0.1|Y5241_ARATH RecName: Full=Probable receptor-like protein kinase At5g24010; Flags: Precursor gi|9758225|dbj|BAB08724.1| receptor-protein kinase-like protein [Arabidopsis thaliana] gi|332005862|gb|AED93245.1| putative receptor-like protein kinase [Arabidopsis thaliana] Length = 824 Score = 60.8 bits (146), Expect = 2e-07 Identities = 27/56 (48%), Positives = 40/56 (71%) Frame = +2 Query: 200 ATTWSITLTNTNPSPNLSTLYHMARVFTGALSYNFKIEKIGTHFIRIHLSPFKSQK 367 +T SI++++TNPSP+ LY+ ARVF SY F++ GTHFIR+H +PFK+ + Sbjct: 63 STDRSISISDTNPSPDSPVLYNTARVFPVGGSYKFQVTTKGTHFIRLHFAPFKASR 118 >gb|EYU19577.1| hypothetical protein MIMGU_mgv1a020464mg [Mimulus guttatus] Length = 756 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/50 (54%), Positives = 35/50 (70%) Frame = +2 Query: 212 SITLTNTNPSPNLSTLYHMARVFTGALSYNFKIEKIGTHFIRIHLSPFKS 361 SI+L N NP PN S L+ ARVFT A +Y+F+I GTHF+R+H PF + Sbjct: 58 SISLNNPNPPPNSSALHTSARVFTSASTYSFQINNPGTHFLRLHFYPFSN 107