BLASTX nr result
ID: Paeonia23_contig00012549
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00012549 (418 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002510849.1| ATNAP8, putative [Ricinus communis] gi|22354... 56 5e-06 gb|EYU25050.1| hypothetical protein MIMGU_mgv1a002173mg [Mimulus... 56 6e-06 >ref|XP_002510849.1| ATNAP8, putative [Ricinus communis] gi|223549964|gb|EEF51451.1| ATNAP8, putative [Ricinus communis] Length = 712 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/52 (50%), Positives = 34/52 (65%), Gaps = 1/52 (1%) Frame = -2 Query: 153 TNPFAYISGPVFTSESDPKVDGSDLRASDVQPQ-KAVTWGLVWTLLMRHKLR 1 T P AY+SGP E +PKV SD + VQ K ++WGL+W+LL+ HKLR Sbjct: 55 TIPCAYVSGPPTVGEPEPKVKASDATSEKVQESPKVISWGLLWSLLLNHKLR 106 >gb|EYU25050.1| hypothetical protein MIMGU_mgv1a002173mg [Mimulus guttatus] Length = 705 Score = 55.8 bits (133), Expect = 6e-06 Identities = 29/59 (49%), Positives = 40/59 (67%), Gaps = 3/59 (5%) Frame = -2 Query: 168 RRARTTNPFAYISGPVF---TSESDPKVDGSDLRASDVQPQKAVTWGLVWTLLMRHKLR 1 RR+R + AY+SGP F SE+DPK+DGSD ++QP ++WGL+W L+ RHK R Sbjct: 44 RRSRIISR-AYVSGPAFDAIVSENDPKIDGSD--TVELQPIDLISWGLLWKLVSRHKWR 99