BLASTX nr result
ID: Paeonia23_contig00011421
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00011421 (741 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004493865.1| PREDICTED: 26S proteasome regulatory subunit... 60 1e-06 ref|XP_004152012.1| PREDICTED: 26S proteasome regulatory subunit... 59 2e-06 ref|XP_007162652.1| hypothetical protein PHAVU_001G168800g [Phas... 59 2e-06 ref|XP_006443671.1| hypothetical protein CICLE_v10020143mg [Citr... 59 2e-06 ref|XP_007048402.1| Regulatory particle AAA-ATPase 2A isoform 2 ... 59 2e-06 ref|XP_007048401.1| Regulatory particle AAA-ATPase 2A isoform 1 ... 59 2e-06 ref|XP_003521331.1| PREDICTED: 26S proteasome regulatory subunit... 59 2e-06 ref|XP_003554317.1| PREDICTED: 26S proteasome regulatory subunit... 59 2e-06 dbj|BAJ79010.1| regulatory particle triple-A ATPase 2 [Sophora f... 59 2e-06 ref|XP_007144443.1| hypothetical protein PHAVU_007G156500g [Phas... 58 3e-06 gb|AAF22522.1|AF123391_1 26S proteasome AAA-ATPase subunit RPT2a... 58 4e-06 ref|XP_002526219.1| 26S protease regulatory subunit, putative [R... 58 4e-06 ref|XP_002263334.1| PREDICTED: 26S proteasome regulatory subunit... 58 4e-06 ref|XP_002320617.2| hypothetical protein POPTR_0014s18530g [Popu... 57 5e-06 gb|EPS64118.1| hypothetical protein M569_10659 [Genlisea aurea] 57 5e-06 ref|XP_004290031.1| PREDICTED: 26S proteasome regulatory subunit... 57 5e-06 ref|XP_002521148.1| 26S protease regulatory subunit, putative [R... 57 5e-06 gb|EYU17968.1| hypothetical protein MIMGU_mgv1a006475mg [Mimulus... 57 9e-06 gb|EXC24146.1| 26S proteasome regulatory subunit 4-B-like protei... 57 9e-06 >ref|XP_004493865.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog A-like [Cicer arietinum] Length = 446 Score = 59.7 bits (143), Expect = 1e-06 Identities = 34/60 (56%), Positives = 42/60 (70%), Gaps = 4/60 (6%) Frame = +1 Query: 274 RIV*KYQKQNGPQSW----TVTPLSKYNMR*KKLEPIKSYLLIKDEFMVN*ERLKPQEGK 441 R+ K +KQ GP+S TVTPLSK +R KLE IK YLL+++EF+ N ERLKPQE K Sbjct: 38 RVGRKQRKQKGPESAARLPTVTPLSKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEK 97 >ref|XP_004152012.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog B-like [Cucumis sativus] gi|449515803|ref|XP_004164937.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog B-like [Cucumis sativus] Length = 445 Score = 58.9 bits (141), Expect = 2e-06 Identities = 32/61 (52%), Positives = 43/61 (70%), Gaps = 4/61 (6%) Frame = +1 Query: 271 TRIV*KYQKQNGPQSW----TVTPLSKYNMR*KKLEPIKSYLLIKDEFMVN*ERLKPQEG 438 TR+ K +KQ GP++ TVTPL+K +R KLE +K YLL+++EF+ N ERLKPQE Sbjct: 36 TRVGRKQRKQKGPEAAARLPTVTPLTKCRLRLLKLERVKDYLLMEEEFVTNQERLKPQEE 95 Query: 439 K 441 K Sbjct: 96 K 96 >ref|XP_007162652.1| hypothetical protein PHAVU_001G168800g [Phaseolus vulgaris] gi|561036116|gb|ESW34646.1| hypothetical protein PHAVU_001G168800g [Phaseolus vulgaris] Length = 446 Score = 58.5 bits (140), Expect = 2e-06 Identities = 33/60 (55%), Positives = 42/60 (70%), Gaps = 4/60 (6%) Frame = +1 Query: 274 RIV*KYQKQNGPQSW----TVTPLSKYNMR*KKLEPIKSYLLIKDEFMVN*ERLKPQEGK 441 R+ K +KQ GP++ TVTPLSK +R KLE IK YLL+++EF+ N ERLKPQE K Sbjct: 38 RVGRKQRKQKGPEAAARLPTVTPLSKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEK 97 >ref|XP_006443671.1| hypothetical protein CICLE_v10020143mg [Citrus clementina] gi|568853056|ref|XP_006480183.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog A-like [Citrus sinensis] gi|557545933|gb|ESR56911.1| hypothetical protein CICLE_v10020143mg [Citrus clementina] Length = 446 Score = 58.5 bits (140), Expect = 2e-06 Identities = 33/60 (55%), Positives = 42/60 (70%), Gaps = 4/60 (6%) Frame = +1 Query: 274 RIV*KYQKQNGPQSW----TVTPLSKYNMR*KKLEPIKSYLLIKDEFMVN*ERLKPQEGK 441 R+ K +KQ GP++ TVTPLSK +R KLE IK YLL+++EF+ N ERLKPQE K Sbjct: 38 RVGRKQRKQKGPEAAARLPTVTPLSKCKLRLLKLERIKDYLLMEEEFVTNQERLKPQEEK 97 >ref|XP_007048402.1| Regulatory particle AAA-ATPase 2A isoform 2 [Theobroma cacao] gi|508700663|gb|EOX92559.1| Regulatory particle AAA-ATPase 2A isoform 2 [Theobroma cacao] Length = 382 Score = 58.5 bits (140), Expect = 2e-06 Identities = 33/60 (55%), Positives = 42/60 (70%), Gaps = 4/60 (6%) Frame = +1 Query: 274 RIV*KYQKQNGPQSW----TVTPLSKYNMR*KKLEPIKSYLLIKDEFMVN*ERLKPQEGK 441 R+ K +KQ GP++ TVTPLSK +R KLE IK YLL+++EF+ N ERLKPQE K Sbjct: 38 RVGRKQRKQKGPEAAARLPTVTPLSKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEK 97 >ref|XP_007048401.1| Regulatory particle AAA-ATPase 2A isoform 1 [Theobroma cacao] gi|508700662|gb|EOX92558.1| Regulatory particle AAA-ATPase 2A isoform 1 [Theobroma cacao] Length = 446 Score = 58.5 bits (140), Expect = 2e-06 Identities = 33/60 (55%), Positives = 42/60 (70%), Gaps = 4/60 (6%) Frame = +1 Query: 274 RIV*KYQKQNGPQSW----TVTPLSKYNMR*KKLEPIKSYLLIKDEFMVN*ERLKPQEGK 441 R+ K +KQ GP++ TVTPLSK +R KLE IK YLL+++EF+ N ERLKPQE K Sbjct: 38 RVGRKQRKQKGPEAAARLPTVTPLSKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEK 97 >ref|XP_003521331.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog A [Glycine max] Length = 446 Score = 58.5 bits (140), Expect = 2e-06 Identities = 33/60 (55%), Positives = 42/60 (70%), Gaps = 4/60 (6%) Frame = +1 Query: 274 RIV*KYQKQNGPQSW----TVTPLSKYNMR*KKLEPIKSYLLIKDEFMVN*ERLKPQEGK 441 R+ K +KQ GP++ TVTPLSK +R KLE IK YLL+++EF+ N ERLKPQE K Sbjct: 38 RVGRKQRKQKGPEAAARLPTVTPLSKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEK 97 >ref|XP_003554317.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog A [Glycine max] Length = 446 Score = 58.5 bits (140), Expect = 2e-06 Identities = 33/60 (55%), Positives = 42/60 (70%), Gaps = 4/60 (6%) Frame = +1 Query: 274 RIV*KYQKQNGPQSW----TVTPLSKYNMR*KKLEPIKSYLLIKDEFMVN*ERLKPQEGK 441 R+ K +KQ GP++ TVTPLSK +R KLE IK YLL+++EF+ N ERLKPQE K Sbjct: 38 RVGRKQRKQKGPEAAARLPTVTPLSKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEK 97 >dbj|BAJ79010.1| regulatory particle triple-A ATPase 2 [Sophora flavescens] Length = 446 Score = 58.5 bits (140), Expect = 2e-06 Identities = 33/60 (55%), Positives = 42/60 (70%), Gaps = 4/60 (6%) Frame = +1 Query: 274 RIV*KYQKQNGPQSW----TVTPLSKYNMR*KKLEPIKSYLLIKDEFMVN*ERLKPQEGK 441 R+ K +KQ GP++ TVTPLSK +R KLE IK YLL+++EF+ N ERLKPQE K Sbjct: 38 RVGRKQRKQKGPEAAARLPTVTPLSKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEK 97 >ref|XP_007144443.1| hypothetical protein PHAVU_007G156500g [Phaseolus vulgaris] gi|561017633|gb|ESW16437.1| hypothetical protein PHAVU_007G156500g [Phaseolus vulgaris] Length = 443 Score = 58.2 bits (139), Expect = 3e-06 Identities = 32/61 (52%), Positives = 43/61 (70%), Gaps = 4/61 (6%) Frame = +1 Query: 271 TRIV*KYQKQNGPQSW----TVTPLSKYNMR*KKLEPIKSYLLIKDEFMVN*ERLKPQEG 438 TR+ K +KQ GP++ TVTP++K +R KLE IK YLL+++EF+ N ERLKPQE Sbjct: 34 TRVGRKQRKQKGPEAAARLPTVTPVTKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEE 93 Query: 439 K 441 K Sbjct: 94 K 94 >gb|AAF22522.1|AF123391_1 26S proteasome AAA-ATPase subunit RPT2a [Arabidopsis thaliana] Length = 443 Score = 57.8 bits (138), Expect = 4e-06 Identities = 32/60 (53%), Positives = 42/60 (70%), Gaps = 4/60 (6%) Frame = +1 Query: 274 RIV*KYQKQNGPQSW----TVTPLSKYNMR*KKLEPIKSYLLIKDEFMVN*ERLKPQEGK 441 R+V K +KQ GP++ TVTP +K +R KLE IK YLL+++EF+ N ERLKPQE K Sbjct: 35 RVVRKQRKQKGPEAAARLPTVTPSTKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEK 94 >ref|XP_002526219.1| 26S protease regulatory subunit, putative [Ricinus communis] gi|223534458|gb|EEF36160.1| 26S protease regulatory subunit, putative [Ricinus communis] Length = 443 Score = 57.8 bits (138), Expect = 4e-06 Identities = 32/61 (52%), Positives = 43/61 (70%), Gaps = 4/61 (6%) Frame = +1 Query: 271 TRIV*KYQKQNGPQSW----TVTPLSKYNMR*KKLEPIKSYLLIKDEFMVN*ERLKPQEG 438 +R+ K +KQ GP++ TVTPL+K +R KLE IK YLL+++EF+ N ERLKPQE Sbjct: 34 SRVGRKQRKQKGPEAAARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEE 93 Query: 439 K 441 K Sbjct: 94 K 94 >ref|XP_002263334.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog A [Vitis vinifera] gi|147860799|emb|CAN78907.1| hypothetical protein VITISV_029788 [Vitis vinifera] Length = 445 Score = 57.8 bits (138), Expect = 4e-06 Identities = 33/60 (55%), Positives = 42/60 (70%), Gaps = 4/60 (6%) Frame = +1 Query: 274 RIV*KYQKQNGPQSW----TVTPLSKYNMR*KKLEPIKSYLLIKDEFMVN*ERLKPQEGK 441 R+ K +KQ GP++ TVTPLSK +R KLE IK YLL+++EF+ N ERLKPQE K Sbjct: 37 RVGRKQRKQKGPEAAARLPTVTPLSKCKLRLLKLERIKDYLLMEEEFVSNQERLKPQEEK 96 >ref|XP_002320617.2| hypothetical protein POPTR_0014s18530g [Populus trichocarpa] gi|550324494|gb|EEE98932.2| hypothetical protein POPTR_0014s18530g [Populus trichocarpa] Length = 423 Score = 57.4 bits (137), Expect = 5e-06 Identities = 32/60 (53%), Positives = 42/60 (70%), Gaps = 4/60 (6%) Frame = +1 Query: 274 RIV*KYQKQNGPQSW----TVTPLSKYNMR*KKLEPIKSYLLIKDEFMVN*ERLKPQEGK 441 R+ K +KQ GP++ TVTPL+K +R KLE IK YLL+++EF+ N ERLKPQE K Sbjct: 37 RVGRKQRKQKGPEAAARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEK 96 >gb|EPS64118.1| hypothetical protein M569_10659 [Genlisea aurea] Length = 444 Score = 57.4 bits (137), Expect = 5e-06 Identities = 32/60 (53%), Positives = 42/60 (70%), Gaps = 4/60 (6%) Frame = +1 Query: 274 RIV*KYQKQNGPQSW----TVTPLSKYNMR*KKLEPIKSYLLIKDEFMVN*ERLKPQEGK 441 R+ K +KQ GP++ TVTPL+K +R KLE IK YLL+++EF+ N ERLKPQE K Sbjct: 36 RVGRKQRKQKGPEAAARIPTVTPLTKCKLRLLKLERIKDYLLMEEEFVTNQERLKPQEEK 95 >ref|XP_004290031.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog A-like [Fragaria vesca subsp. vesca] Length = 446 Score = 57.4 bits (137), Expect = 5e-06 Identities = 32/60 (53%), Positives = 42/60 (70%), Gaps = 4/60 (6%) Frame = +1 Query: 274 RIV*KYQKQNGPQSW----TVTPLSKYNMR*KKLEPIKSYLLIKDEFMVN*ERLKPQEGK 441 R+ K +KQ GP++ TVTPL+K +R KLE IK YLL+++EF+ N ERLKPQE K Sbjct: 38 RVGRKQRKQKGPEAAARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVTNQERLKPQEEK 97 >ref|XP_002521148.1| 26S protease regulatory subunit, putative [Ricinus communis] gi|223539717|gb|EEF41299.1| 26S protease regulatory subunit, putative [Ricinus communis] Length = 399 Score = 57.4 bits (137), Expect = 5e-06 Identities = 32/60 (53%), Positives = 42/60 (70%), Gaps = 4/60 (6%) Frame = +1 Query: 274 RIV*KYQKQNGPQSW----TVTPLSKYNMR*KKLEPIKSYLLIKDEFMVN*ERLKPQEGK 441 R+ K +KQ GP++ TVTPL+K +R KLE IK YLL+++EF+ N ERLKPQE K Sbjct: 36 RVGRKQRKQKGPEAAARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEK 95 >gb|EYU17968.1| hypothetical protein MIMGU_mgv1a006475mg [Mimulus guttatus] Length = 443 Score = 56.6 bits (135), Expect = 9e-06 Identities = 32/60 (53%), Positives = 41/60 (68%), Gaps = 4/60 (6%) Frame = +1 Query: 274 RIV*KYQKQNGPQSW----TVTPLSKYNMR*KKLEPIKSYLLIKDEFMVN*ERLKPQEGK 441 R+ K +KQ GP + TVTPL+K +R KLE IK YLL+++EF+ N ERLKPQE K Sbjct: 35 RVGRKQRKQKGPDAAARIPTVTPLTKCKLRFLKLERIKDYLLMEEEFVANQERLKPQEEK 94 >gb|EXC24146.1| 26S proteasome regulatory subunit 4-B-like protein [Morus notabilis] Length = 446 Score = 56.6 bits (135), Expect = 9e-06 Identities = 32/60 (53%), Positives = 42/60 (70%), Gaps = 4/60 (6%) Frame = +1 Query: 274 RIV*KYQKQNGPQSW----TVTPLSKYNMR*KKLEPIKSYLLIKDEFMVN*ERLKPQEGK 441 R+ K +KQ GP++ TVTPL+K +R KLE IK YLL+++EF+ N ERLKPQE K Sbjct: 38 RVGRKQRKQKGPEAAARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVSNQERLKPQEEK 97