BLASTX nr result
ID: Paeonia23_contig00011218
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00011218 (281 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003626141.1| RNA-binding protein [Medicago truncatula] gi... 66 4e-09 emb|CAD56221.1| hypothetical protein [Cicer arietinum] 64 2e-08 >ref|XP_003626141.1| RNA-binding protein [Medicago truncatula] gi|355501156|gb|AES82359.1| RNA-binding protein [Medicago truncatula] Length = 454 Score = 66.2 bits (160), Expect = 4e-09 Identities = 31/48 (64%), Positives = 39/48 (81%) Frame = +1 Query: 46 SAVFITLLASTACFMHNMKVQVIAEQEHKIQTEV*EIHKVFSSDLCNK 189 S F L+AS+ACF+HN+K+QV+AE+E KIQTEV EI KVF +LCNK Sbjct: 269 SCSFYYLVASSACFVHNLKIQVLAEREQKIQTEVKEIRKVFFCELCNK 316 >emb|CAD56221.1| hypothetical protein [Cicer arietinum] Length = 206 Score = 63.9 bits (154), Expect = 2e-08 Identities = 31/48 (64%), Positives = 38/48 (79%) Frame = +1 Query: 46 SAVFITLLASTACFMHNMKVQVIAEQEHKIQTEV*EIHKVFSSDLCNK 189 S F L+AS+ACF+H MK+QV+AE+E KIQTEV EI KVF +LCNK Sbjct: 21 SCSFYYLVASSACFVHIMKIQVLAEREQKIQTEVKEIRKVFYCELCNK 68