BLASTX nr result
ID: Paeonia23_contig00011210
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00011210 (253 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|WP_008748712.1| hypothetical protein, partial [Streptomyces ... 130 2e-28 ref|WP_009063254.1| conserved hypothetical protein, partial [Str... 107 2e-24 ref|WP_005314063.1| conserved hypothetical protein, partial [Str... 107 2e-24 ref|WP_005311167.1| conserved hypothetical protein, partial [Str... 107 2e-24 ref|WP_007381065.1| conserved hypothetical protein, partial [Str... 103 2e-24 ref|WP_003993384.1| hypothetical protein [Streptomyces viridochr... 107 2e-24 ref|WP_003975503.1| hypothetical protein [Streptomyces lividans]... 103 2e-24 ref|WP_006123540.1| conserved hypothetical protein, partial [Str... 115 5e-24 ref|WP_004930641.1| hypothetical protein [Streptomyces griseofla... 102 2e-22 ref|WP_007385104.1| conserved hypothetical protein, partial [Str... 96 3e-22 ref|WP_004984910.1| conserved hypothetical protein, partial [Str... 101 4e-22 ref|WP_009187877.1| hypothetical protein [Streptomyces sp. e14] ... 100 1e-21 ref|WP_009068222.1| conserved hypothetical protein, partial [Str... 96 5e-21 ref|WP_009714633.1| hypothetical protein, partial [Streptomyces ... 99 8e-19 ref|WP_006123541.1| conserved hypothetical protein, partial [Str... 96 4e-18 ref|WP_003974848.1| hydrolase [Streptomyces lividans] gi|2897004... 93 4e-17 ref|WP_004986323.1| hydrolase [Streptomyces ghanaensis] gi|29134... 91 2e-16 ref|WP_008746630.1| hypothetical protein, partial [Streptomyces ... 91 2e-16 ref|WP_009188945.1| hydrolase [Streptomyces sp. e14] gi|29283302... 90 4e-16 ref|WP_008749165.1| conserved hypothetical protein, partial [Str... 89 8e-16 >ref|WP_008748712.1| hypothetical protein, partial [Streptomyces sp. SPB74] gi|295827601|gb|EDY46972.2| hypothetical protein SSBG_04935 [Streptomyces sp. SPB74] Length = 77 Score = 130 bits (327), Expect = 2e-28 Identities = 56/60 (93%), Positives = 57/60 (95%) Frame = +1 Query: 1 GFHIWPINPVVYWEP*PLKGGGNTHLEAGFPLRCFQRLSFPNVANQPCPWQDNWHTRGSS 180 GFHI PINPVVYWEP PLKGGGNTHLEAGFPLRCFQRLS PNVANQPCPWQ+NWHTRGSS Sbjct: 18 GFHIRPINPVVYWEPYPLKGGGNTHLEAGFPLRCFQRLSLPNVANQPCPWQNNWHTRGSS 77 >ref|WP_009063254.1| conserved hypothetical protein, partial [Streptomyces sp. SPB78] gi|302426768|gb|EFK98583.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Streptomyces sp. SPB78] gi|302429649|gb|EFL01465.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Streptomyces sp. SPB78] gi|302429953|gb|EFL01769.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Streptomyces sp. SPB78] Length = 74 Score = 107 bits (268), Expect(2) = 2e-24 Identities = 46/50 (92%), Positives = 48/50 (96%) Frame = +1 Query: 49 PLKGGGNTHLEAGFPLRCFQRLSFPNVANQPCPWQDNWHTRGSSVPVLSY 198 P +GGGNTHLEAGFPLRCFQRLS PNVANQPCPWQ+NWHTRGSSVPVLSY Sbjct: 25 PSQGGGNTHLEAGFPLRCFQRLSLPNVANQPCPWQNNWHTRGSSVPVLSY 74 Score = 30.4 bits (67), Expect(2) = 2e-24 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = +3 Query: 3 LPHLAYQPSRLLGALTPQ 56 LP+ AYQPSRLLGAL Q Sbjct: 10 LPYPAYQPSRLLGALPSQ 27 >ref|WP_005314063.1| conserved hypothetical protein, partial [Streptomyces pristinaespiralis] gi|297151538|gb|EDY66056.2| LOW QUALITY PROTEIN: conserved hypothetical protein [Streptomyces pristinaespiralis ATCC 25486] gi|297152877|gb|EFH32044.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Streptomyces pristinaespiralis ATCC 25486] Length = 74 Score = 107 bits (268), Expect(2) = 2e-24 Identities = 46/50 (92%), Positives = 48/50 (96%) Frame = +1 Query: 49 PLKGGGNTHLEAGFPLRCFQRLSFPNVANQPCPWQDNWHTRGSSVPVLSY 198 P +GGG+ HLEAGFPLRCFQRLSFPNVANQPCPWQDNWHTRGSSVPVLSY Sbjct: 25 PSQGGGSPHLEAGFPLRCFQRLSFPNVANQPCPWQDNWHTRGSSVPVLSY 74 Score = 30.4 bits (67), Expect(2) = 2e-24 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = +3 Query: 3 LPHLAYQPSRLLGALTPQ 56 LP+ AYQPSRLLGAL Q Sbjct: 10 LPYPAYQPSRLLGALPSQ 27 >ref|WP_005311167.1| conserved hypothetical protein, partial [Streptomyces pristinaespiralis] gi|297151020|gb|EDY65528.2| LOW QUALITY PROTEIN: conserved hypothetical protein [Streptomyces pristinaespiralis ATCC 25486] gi|297151807|gb|EFH31361.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Streptomyces pristinaespiralis ATCC 25486] Length = 74 Score = 107 bits (268), Expect(2) = 2e-24 Identities = 46/50 (92%), Positives = 48/50 (96%) Frame = +1 Query: 49 PLKGGGNTHLEAGFPLRCFQRLSFPNVANQPCPWQDNWHTRGSSVPVLSY 198 P +GGG+ HLEAGFPLRCFQRLSFPNVANQPCPWQDNWHTRGSSVPVLSY Sbjct: 25 PSQGGGSPHLEAGFPLRCFQRLSFPNVANQPCPWQDNWHTRGSSVPVLSY 74 Score = 30.4 bits (67), Expect(2) = 2e-24 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = +3 Query: 3 LPHLAYQPSRLLGALTPQ 56 LP+ AYQPSRLLGAL Q Sbjct: 10 LPYPAYQPSRLLGALPSQ 27 >ref|WP_007381065.1| conserved hypothetical protein, partial [Streptomyces sviceus] gi|297147181|gb|EFH28519.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Streptomyces sviceus ATCC 29083] gi|297147699|gb|EFH28707.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Streptomyces sviceus ATCC 29083] gi|297147892|gb|EFH28779.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Streptomyces sviceus ATCC 29083] Length = 74 Score = 103 bits (257), Expect(2) = 2e-24 Identities = 44/48 (91%), Positives = 46/48 (95%) Frame = +1 Query: 55 KGGGNTHLEAGFPLRCFQRLSFPNVANQPCPWQDNWHTRGSSVPVLSY 198 +GGG+ HLEAGFPLRCFQRLS PNVANQPCPWQDNWHTRGSSVPVLSY Sbjct: 27 QGGGSPHLEAGFPLRCFQRLSLPNVANQPCPWQDNWHTRGSSVPVLSY 74 Score = 34.7 bits (78), Expect(2) = 2e-24 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = +3 Query: 3 LPHLAYQPSRLLGALTPQ 56 LP AYQPSRLLGALTPQ Sbjct: 10 LPDPAYQPSRLLGALTPQ 27 >ref|WP_003993384.1| hypothetical protein [Streptomyces viridochromogenes] gi|302472168|gb|EFL35261.1| conserved hypothetical protein [Streptomyces viridochromogenes DSM 40736] Length = 66 Score = 107 bits (268), Expect(2) = 2e-24 Identities = 46/50 (92%), Positives = 48/50 (96%) Frame = +1 Query: 49 PLKGGGNTHLEAGFPLRCFQRLSFPNVANQPCPWQDNWHTRGSSVPVLSY 198 P +GGGNTHLEAGFPLRCFQRLS PNVANQPCPWQ+NWHTRGSSVPVLSY Sbjct: 17 PSQGGGNTHLEAGFPLRCFQRLSLPNVANQPCPWQNNWHTRGSSVPVLSY 66 Score = 30.4 bits (67), Expect(2) = 2e-24 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = +3 Query: 3 LPHLAYQPSRLLGALTPQ 56 LP+ AYQPSRLLGAL Q Sbjct: 2 LPYPAYQPSRLLGALPSQ 19 >ref|WP_003975503.1| hypothetical protein [Streptomyces lividans] gi|289701157|gb|EFD68586.1| conserved hypothetical protein [Streptomyces lividans TK24] gi|289701450|gb|EFD68879.1| conserved hypothetical protein [Streptomyces lividans TK24] gi|289702690|gb|EFD70119.1| conserved hypothetical protein [Streptomyces lividans TK24] gi|289703100|gb|EFD70529.1| conserved hypothetical protein [Streptomyces lividans TK24] Length = 66 Score = 103 bits (257), Expect(2) = 2e-24 Identities = 44/48 (91%), Positives = 46/48 (95%) Frame = +1 Query: 55 KGGGNTHLEAGFPLRCFQRLSFPNVANQPCPWQDNWHTRGSSVPVLSY 198 +GGG+ HLEAGFPLRCFQRLS PNVANQPCPWQDNWHTRGSSVPVLSY Sbjct: 19 QGGGSPHLEAGFPLRCFQRLSLPNVANQPCPWQDNWHTRGSSVPVLSY 66 Score = 34.7 bits (78), Expect(2) = 2e-24 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = +3 Query: 3 LPHLAYQPSRLLGALTPQ 56 LP AYQPSRLLGALTPQ Sbjct: 2 LPDPAYQPSRLLGALTPQ 19 >ref|WP_006123540.1| conserved hypothetical protein, partial [Streptomyces filamentosus] gi|291346639|gb|EFE73543.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Streptomyces roseosporus NRRL 15998] gi|291348565|gb|EFE75469.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Streptomyces roseosporus NRRL 15998] gi|291348853|gb|EFE75757.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Streptomyces roseosporus NRRL 15998] Length = 50 Score = 115 bits (289), Expect = 5e-24 Identities = 50/50 (100%), Positives = 50/50 (100%) Frame = +1 Query: 49 PLKGGGNTHLEAGFPLRCFQRLSFPNVANQPCPWQDNWHTRGSSVPVLSY 198 PLKGGGNTHLEAGFPLRCFQRLSFPNVANQPCPWQDNWHTRGSSVPVLSY Sbjct: 1 PLKGGGNTHLEAGFPLRCFQRLSFPNVANQPCPWQDNWHTRGSSVPVLSY 50 >ref|WP_004930641.1| hypothetical protein [Streptomyces griseoflavus] gi|302477944|gb|EFL41037.1| hypothetical protein SSRG_03841 [Streptomyces griseoflavus Tu4000] Length = 66 Score = 102 bits (254), Expect(2) = 2e-22 Identities = 44/50 (88%), Positives = 46/50 (92%) Frame = +1 Query: 49 PLKGGGNTHLEAGFPLRCFQRLSFPNVANQPCPWQDNWHTRGSSVPVLSY 198 P GGG+ HLEAGFPLRCFQRLS PNVANQPCPWQ+NWHTRGSSVPVLSY Sbjct: 17 PSLGGGSPHLEAGFPLRCFQRLSLPNVANQPCPWQNNWHTRGSSVPVLSY 66 Score = 29.3 bits (64), Expect(2) = 2e-22 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = +3 Query: 3 LPHLAYQPSRLLGAL 47 LP+ AYQPSRLLGAL Sbjct: 2 LPYPAYQPSRLLGAL 16 >ref|WP_007385104.1| conserved hypothetical protein, partial [Streptomyces sviceus] gi|297148196|gb|EFH28880.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Streptomyces sviceus ATCC 29083] Length = 70 Score = 96.3 bits (238), Expect(2) = 3e-22 Identities = 40/44 (90%), Positives = 42/44 (95%) Frame = +1 Query: 55 KGGGNTHLEAGFPLRCFQRLSFPNVANQPCPWQDNWHTRGSSVP 186 +GGG+ HLEAGFPLRCFQRLS PNVANQPCPWQDNWHTRGSSVP Sbjct: 27 QGGGSPHLEAGFPLRCFQRLSLPNVANQPCPWQDNWHTRGSSVP 70 Score = 34.7 bits (78), Expect(2) = 3e-22 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = +3 Query: 3 LPHLAYQPSRLLGALTPQ 56 LP AYQPSRLLGALTPQ Sbjct: 10 LPDPAYQPSRLLGALTPQ 27 >ref|WP_004984910.1| conserved hypothetical protein, partial [Streptomyces ghanaensis] gi|291340927|gb|EFE67883.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Streptomyces ghanaensis ATCC 14672] gi|291341606|gb|EFE68562.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Streptomyces ghanaensis ATCC 14672] gi|291342163|gb|EFE69119.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Streptomyces ghanaensis ATCC 14672] gi|291343781|gb|EFE70737.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Streptomyces ghanaensis ATCC 14672] Length = 74 Score = 101 bits (252), Expect(2) = 4e-22 Identities = 44/50 (88%), Positives = 46/50 (92%) Frame = +1 Query: 49 PLKGGGNTHLEAGFPLRCFQRLSFPNVANQPCPWQDNWHTRGSSVPVLSY 198 P + GG+ HLEAGFPLRCFQRLS PNVANQPCPWQDNWHTRGSSVPVLSY Sbjct: 25 PHQVGGSPHLEAGFPLRCFQRLSLPNVANQPCPWQDNWHTRGSSVPVLSY 74 Score = 28.9 bits (63), Expect(2) = 4e-22 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +3 Query: 3 LPHLAYQPSRLLGALTPQ 56 LP AYQPSRLLGAL Q Sbjct: 10 LPDPAYQPSRLLGALPHQ 27 >ref|WP_009187877.1| hypothetical protein [Streptomyces sp. e14] gi|292830510|gb|EFF88860.1| hypothetical protein SSTG_04730 [Streptomyces sp. e14] gi|292831950|gb|EFF90299.1| hypothetical protein SSTG_00617 [Streptomyces sp. e14] gi|292833022|gb|EFF91371.1| hypothetical protein SSTG_01690 [Streptomyces sp. e14] gi|292833480|gb|EFF91829.1| hypothetical protein SSTG_02148 [Streptomyces sp. e14] gi|292834018|gb|EFF92367.1| hypothetical protein SSTG_02686 [Streptomyces sp. e14] Length = 66 Score = 99.8 bits (247), Expect(2) = 1e-21 Identities = 43/50 (86%), Positives = 46/50 (92%) Frame = +1 Query: 49 PLKGGGNTHLEAGFPLRCFQRLSFPNVANQPCPWQDNWHTRGSSVPVLSY 198 P + GG+ HLEAGFPLRCFQRLS PNVANQPCPWQ+NWHTRGSSVPVLSY Sbjct: 17 PHQVGGSPHLEAGFPLRCFQRLSLPNVANQPCPWQNNWHTRGSSVPVLSY 66 Score = 28.9 bits (63), Expect(2) = 1e-21 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +3 Query: 3 LPHLAYQPSRLLGALTPQ 56 LP AYQPSRLLGAL Q Sbjct: 2 LPDPAYQPSRLLGALPHQ 19 >ref|WP_009068222.1| conserved hypothetical protein, partial [Streptomyces sp. SPB78] gi|302430314|gb|EFL02130.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Streptomyces sp. SPB78] Length = 68 Score = 96.3 bits (238), Expect(2) = 5e-21 Identities = 40/44 (90%), Positives = 42/44 (95%) Frame = +1 Query: 49 PLKGGGNTHLEAGFPLRCFQRLSFPNVANQPCPWQDNWHTRGSS 180 P +GGGNTHLEAGFPLRCFQRLS PNVANQPCPWQ+NWHTRGSS Sbjct: 25 PSQGGGNTHLEAGFPLRCFQRLSLPNVANQPCPWQNNWHTRGSS 68 Score = 30.4 bits (67), Expect(2) = 5e-21 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = +3 Query: 3 LPHLAYQPSRLLGALTPQ 56 LP+ AYQPSRLLGAL Q Sbjct: 10 LPYPAYQPSRLLGALPSQ 27 >ref|WP_009714633.1| hypothetical protein, partial [Streptomyces himastatinicus] gi|302459719|gb|EFL22812.1| LOW QUALITY PROTEIN: hypothetical protein SSOG_02526 [Streptomyces himastatinicus ATCC 53653] Length = 74 Score = 98.6 bits (244), Expect = 8e-19 Identities = 46/64 (71%), Positives = 50/64 (78%), Gaps = 6/64 (9%) Frame = +1 Query: 25 PVVYWEP*PLKG------GGNTHLEAGFPLRCFQRLSFPNVANQPCPWQDNWHTRGSSVP 186 P + ++P L G GG+ HLEAGFPLRCFQRLS PNVANQPCPWQDNWHT GSSVP Sbjct: 11 PYLAYQPSRLLGALTHQVGGSPHLEAGFPLRCFQRLSLPNVANQPCPWQDNWHTGGSSVP 70 Query: 187 VLSY 198 VLSY Sbjct: 71 VLSY 74 >ref|WP_006123541.1| conserved hypothetical protein, partial [Streptomyces filamentosus] gi|291346640|gb|EFE73544.1| conserved hypothetical protein [Streptomyces roseosporus NRRL 15998] Length = 75 Score = 96.3 bits (238), Expect = 4e-18 Identities = 48/51 (94%), Positives = 48/51 (94%) Frame = +3 Query: 99 MLSAVILSERSQPAMPLAGQLAHQRFVRPGPLVLGTALLKFPTRAADRDRT 251 MLSAVILSERSQPAMPLAGQLAHQRFVRPGPLVLGTALL PTR ADRDRT Sbjct: 1 MLSAVILSERSQPAMPLAGQLAHQRFVRPGPLVLGTALLNIPTRTADRDRT 51 >ref|WP_003974848.1| hydrolase [Streptomyces lividans] gi|289700498|gb|EFD67927.1| cell wall-associated hydrolase [Streptomyces lividans TK24] Length = 122 Score = 92.8 bits (229), Expect = 4e-17 Identities = 47/51 (92%), Positives = 47/51 (92%) Frame = +3 Query: 99 MLSAVILSERSQPAMPLAGQLAHQRFVRPGPLVLGTALLKFPTRAADRDRT 251 MLSAVI ERSQPAMPLAGQLAHQRFVRPGPLVLGTALLK PTR ADRDRT Sbjct: 1 MLSAVIPPERSQPAMPLAGQLAHQRFVRPGPLVLGTALLKTPTRTADRDRT 51 >ref|WP_004986323.1| hydrolase [Streptomyces ghanaensis] gi|291341605|gb|EFE68561.1| conserved hypothetical protein [Streptomyces ghanaensis ATCC 14672] Length = 122 Score = 90.9 bits (224), Expect = 2e-16 Identities = 46/51 (90%), Positives = 46/51 (90%) Frame = +3 Query: 99 MLSAVILSERSQPAMPLAGQLAHQRFVRPGPLVLGTALLKFPTRAADRDRT 251 MLSAVI ERSQPAMPLAGQLAHQRFVRPGPLVLGTALLK P R ADRDRT Sbjct: 1 MLSAVIPPERSQPAMPLAGQLAHQRFVRPGPLVLGTALLKTPARTADRDRT 51 >ref|WP_008746630.1| hypothetical protein, partial [Streptomyces sp. SPB74] gi|295826562|gb|EDY44842.2| LOW QUALITY PROTEIN: hypothetical protein SSBG_02741 [Streptomyces sp. SPB74] gi|295827792|gb|EFG65600.1| LOW QUALITY PROTEIN: hypothetical protein SSBG_06429 [Streptomyces sp. SPB74] Length = 60 Score = 90.5 bits (223), Expect = 2e-16 Identities = 40/43 (93%), Positives = 40/43 (93%) Frame = +1 Query: 1 GFHIWPINPVVYWEP*PLKGGGNTHLEAGFPLRCFQRLSFPNV 129 GFHI PINPVVYWEP PLKGGGNTHLEAGFPLRCFQRLS PNV Sbjct: 18 GFHIRPINPVVYWEPYPLKGGGNTHLEAGFPLRCFQRLSLPNV 60 >ref|WP_009188945.1| hydrolase [Streptomyces sp. e14] gi|292833023|gb|EFF91372.1| cell wall-associated hydrolase [Streptomyces sp. e14] Length = 122 Score = 89.7 bits (221), Expect = 4e-16 Identities = 46/51 (90%), Positives = 46/51 (90%) Frame = +3 Query: 99 MLSAVILSERSQPAMPLAGQLAHQRFVRPGPLVLGTALLKFPTRAADRDRT 251 MLSAVI ERSQPAMPLA QLAHQRFVRPGPLVLGTALLK PTR ADRDRT Sbjct: 1 MLSAVIPPERSQPAMPLAEQLAHQRFVRPGPLVLGTALLKTPTRTADRDRT 51 >ref|WP_008749165.1| conserved hypothetical protein, partial [Streptomyces sp. SPB74] gi|295827791|gb|EFG65599.1| conserved hypothetical protein [Streptomyces sp. SPB74] Length = 54 Score = 88.6 bits (218), Expect = 8e-16 Identities = 45/51 (88%), Positives = 45/51 (88%) Frame = +3 Query: 99 MLSAVILSERSQPAMPLAGQLAHQRFVRPGPLVLGTALLKFPTRAADRDRT 251 MLSAVI ERSQPAMPLA QLAHQRFVRPGPLVLGTALL PTR ADRDRT Sbjct: 1 MLSAVIPPERSQPAMPLAEQLAHQRFVRPGPLVLGTALLNIPTRTADRDRT 51