BLASTX nr result
ID: Paeonia23_contig00011209
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00011209 (305 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|WP_004930641.1| hypothetical protein [Streptomyces griseofla... 119 4e-25 ref|WP_003993384.1| hypothetical protein [Streptomyces viridochr... 119 6e-25 ref|WP_009063254.1| conserved hypothetical protein, partial [Str... 118 1e-24 ref|WP_003975503.1| hypothetical protein [Streptomyces lividans]... 118 1e-24 ref|WP_005314063.1| conserved hypothetical protein, partial [Str... 117 1e-24 ref|WP_005311167.1| conserved hypothetical protein, partial [Str... 117 1e-24 ref|WP_007381065.1| conserved hypothetical protein, partial [Str... 117 2e-24 ref|WP_009187877.1| hypothetical protein [Streptomyces sp. e14] ... 116 4e-24 ref|WP_004984910.1| conserved hypothetical protein, partial [Str... 114 1e-23 ref|WP_007385104.1| conserved hypothetical protein, partial [Str... 110 3e-22 ref|WP_009714633.1| hypothetical protein, partial [Streptomyces ... 108 8e-22 ref|WP_009068222.1| conserved hypothetical protein, partial [Str... 106 3e-21 ref|WP_006123540.1| conserved hypothetical protein, partial [Str... 90 3e-16 ref|WP_008748712.1| hypothetical protein, partial [Streptomyces ... 87 2e-15 ref|WP_008603367.1| cell wall-associated hydrolase, partial [Vei... 80 2e-13 ref|WP_008715863.1| cell wall-associated hydrolase [Veillonella ... 80 3e-13 ref|WP_008715884.1| cell wall-associated hydrolase, partial [Vei... 80 3e-13 ref|WP_009188945.1| hydrolase [Streptomyces sp. e14] gi|29283302... 75 1e-11 ref|WP_006805144.1| hypothetical protein [Leptotrichia hofstadii... 75 1e-11 ref|WP_008749165.1| conserved hypothetical protein, partial [Str... 73 5e-11 >ref|WP_004930641.1| hypothetical protein [Streptomyces griseoflavus] gi|302477944|gb|EFL41037.1| hypothetical protein SSRG_03841 [Streptomyces griseoflavus Tu4000] Length = 66 Score = 119 bits (298), Expect = 4e-25 Identities = 54/66 (81%), Positives = 58/66 (87%) Frame = +3 Query: 87 LLPHPAYQPSGLLGASHTQGVWKPHLEAGFPLRCFQRLSLPNVANQPCSWRNNWHTRGSS 266 +LP+PAYQPS LLGA + G PHLEAGFPLRCFQRLSLPNVANQPC W+NNWHTRGSS Sbjct: 1 MLPYPAYQPSRLLGALPSLGGGSPHLEAGFPLRCFQRLSLPNVANQPCPWQNNWHTRGSS 60 Query: 267 VPVLSY 284 VPVLSY Sbjct: 61 VPVLSY 66 >ref|WP_003993384.1| hypothetical protein [Streptomyces viridochromogenes] gi|302472168|gb|EFL35261.1| conserved hypothetical protein [Streptomyces viridochromogenes DSM 40736] Length = 66 Score = 119 bits (297), Expect = 6e-25 Identities = 54/66 (81%), Positives = 58/66 (87%) Frame = +3 Query: 87 LLPHPAYQPSGLLGASHTQGVWKPHLEAGFPLRCFQRLSLPNVANQPCSWRNNWHTRGSS 266 +LP+PAYQPS LLGA +QG HLEAGFPLRCFQRLSLPNVANQPC W+NNWHTRGSS Sbjct: 1 MLPYPAYQPSRLLGALPSQGGGNTHLEAGFPLRCFQRLSLPNVANQPCPWQNNWHTRGSS 60 Query: 267 VPVLSY 284 VPVLSY Sbjct: 61 VPVLSY 66 >ref|WP_009063254.1| conserved hypothetical protein, partial [Streptomyces sp. SPB78] gi|302426768|gb|EFK98583.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Streptomyces sp. SPB78] gi|302429649|gb|EFL01465.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Streptomyces sp. SPB78] gi|302429953|gb|EFL01769.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Streptomyces sp. SPB78] Length = 74 Score = 118 bits (295), Expect = 1e-24 Identities = 54/65 (83%), Positives = 57/65 (87%) Frame = +3 Query: 90 LPHPAYQPSGLLGASHTQGVWKPHLEAGFPLRCFQRLSLPNVANQPCSWRNNWHTRGSSV 269 LP+PAYQPS LLGA +QG HLEAGFPLRCFQRLSLPNVANQPC W+NNWHTRGSSV Sbjct: 10 LPYPAYQPSRLLGALPSQGGGNTHLEAGFPLRCFQRLSLPNVANQPCPWQNNWHTRGSSV 69 Query: 270 PVLSY 284 PVLSY Sbjct: 70 PVLSY 74 >ref|WP_003975503.1| hypothetical protein [Streptomyces lividans] gi|289701157|gb|EFD68586.1| conserved hypothetical protein [Streptomyces lividans TK24] gi|289701450|gb|EFD68879.1| conserved hypothetical protein [Streptomyces lividans TK24] gi|289702690|gb|EFD70119.1| conserved hypothetical protein [Streptomyces lividans TK24] gi|289703100|gb|EFD70529.1| conserved hypothetical protein [Streptomyces lividans TK24] Length = 66 Score = 118 bits (295), Expect = 1e-24 Identities = 54/66 (81%), Positives = 57/66 (86%) Frame = +3 Query: 87 LLPHPAYQPSGLLGASHTQGVWKPHLEAGFPLRCFQRLSLPNVANQPCSWRNNWHTRGSS 266 +LP PAYQPS LLGA QG PHLEAGFPLRCFQRLSLPNVANQPC W++NWHTRGSS Sbjct: 1 MLPDPAYQPSRLLGALTPQGGGSPHLEAGFPLRCFQRLSLPNVANQPCPWQDNWHTRGSS 60 Query: 267 VPVLSY 284 VPVLSY Sbjct: 61 VPVLSY 66 >ref|WP_005314063.1| conserved hypothetical protein, partial [Streptomyces pristinaespiralis] gi|297151538|gb|EDY66056.2| LOW QUALITY PROTEIN: conserved hypothetical protein [Streptomyces pristinaespiralis ATCC 25486] gi|297152877|gb|EFH32044.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Streptomyces pristinaespiralis ATCC 25486] Length = 74 Score = 117 bits (294), Expect = 1e-24 Identities = 53/65 (81%), Positives = 57/65 (87%) Frame = +3 Query: 90 LPHPAYQPSGLLGASHTQGVWKPHLEAGFPLRCFQRLSLPNVANQPCSWRNNWHTRGSSV 269 LP+PAYQPS LLGA +QG PHLEAGFPLRCFQRLS PNVANQPC W++NWHTRGSSV Sbjct: 10 LPYPAYQPSRLLGALPSQGGGSPHLEAGFPLRCFQRLSFPNVANQPCPWQDNWHTRGSSV 69 Query: 270 PVLSY 284 PVLSY Sbjct: 70 PVLSY 74 >ref|WP_005311167.1| conserved hypothetical protein, partial [Streptomyces pristinaespiralis] gi|297151020|gb|EDY65528.2| LOW QUALITY PROTEIN: conserved hypothetical protein [Streptomyces pristinaespiralis ATCC 25486] gi|297151807|gb|EFH31361.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Streptomyces pristinaespiralis ATCC 25486] Length = 74 Score = 117 bits (294), Expect = 1e-24 Identities = 53/65 (81%), Positives = 57/65 (87%) Frame = +3 Query: 90 LPHPAYQPSGLLGASHTQGVWKPHLEAGFPLRCFQRLSLPNVANQPCSWRNNWHTRGSSV 269 LP+PAYQPS LLGA +QG PHLEAGFPLRCFQRLS PNVANQPC W++NWHTRGSSV Sbjct: 10 LPYPAYQPSRLLGALPSQGGGSPHLEAGFPLRCFQRLSFPNVANQPCPWQDNWHTRGSSV 69 Query: 270 PVLSY 284 PVLSY Sbjct: 70 PVLSY 74 >ref|WP_007381065.1| conserved hypothetical protein, partial [Streptomyces sviceus] gi|297147181|gb|EFH28519.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Streptomyces sviceus ATCC 29083] gi|297147699|gb|EFH28707.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Streptomyces sviceus ATCC 29083] gi|297147892|gb|EFH28779.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Streptomyces sviceus ATCC 29083] Length = 74 Score = 117 bits (293), Expect = 2e-24 Identities = 54/65 (83%), Positives = 56/65 (86%) Frame = +3 Query: 90 LPHPAYQPSGLLGASHTQGVWKPHLEAGFPLRCFQRLSLPNVANQPCSWRNNWHTRGSSV 269 LP PAYQPS LLGA QG PHLEAGFPLRCFQRLSLPNVANQPC W++NWHTRGSSV Sbjct: 10 LPDPAYQPSRLLGALTPQGGGSPHLEAGFPLRCFQRLSLPNVANQPCPWQDNWHTRGSSV 69 Query: 270 PVLSY 284 PVLSY Sbjct: 70 PVLSY 74 >ref|WP_009187877.1| hypothetical protein [Streptomyces sp. e14] gi|292830510|gb|EFF88860.1| hypothetical protein SSTG_04730 [Streptomyces sp. e14] gi|292831950|gb|EFF90299.1| hypothetical protein SSTG_00617 [Streptomyces sp. e14] gi|292833022|gb|EFF91371.1| hypothetical protein SSTG_01690 [Streptomyces sp. e14] gi|292833480|gb|EFF91829.1| hypothetical protein SSTG_02148 [Streptomyces sp. e14] gi|292834018|gb|EFF92367.1| hypothetical protein SSTG_02686 [Streptomyces sp. e14] Length = 66 Score = 116 bits (290), Expect = 4e-24 Identities = 54/66 (81%), Positives = 56/66 (84%) Frame = +3 Query: 87 LLPHPAYQPSGLLGASHTQGVWKPHLEAGFPLRCFQRLSLPNVANQPCSWRNNWHTRGSS 266 +LP PAYQPS LLGA Q PHLEAGFPLRCFQRLSLPNVANQPC W+NNWHTRGSS Sbjct: 1 MLPDPAYQPSRLLGALPHQVGGSPHLEAGFPLRCFQRLSLPNVANQPCPWQNNWHTRGSS 60 Query: 267 VPVLSY 284 VPVLSY Sbjct: 61 VPVLSY 66 >ref|WP_004984910.1| conserved hypothetical protein, partial [Streptomyces ghanaensis] gi|291340927|gb|EFE67883.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Streptomyces ghanaensis ATCC 14672] gi|291341606|gb|EFE68562.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Streptomyces ghanaensis ATCC 14672] gi|291342163|gb|EFE69119.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Streptomyces ghanaensis ATCC 14672] gi|291343781|gb|EFE70737.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Streptomyces ghanaensis ATCC 14672] Length = 74 Score = 114 bits (285), Expect = 1e-23 Identities = 53/67 (79%), Positives = 57/67 (85%) Frame = +3 Query: 84 SLLPHPAYQPSGLLGASHTQGVWKPHLEAGFPLRCFQRLSLPNVANQPCSWRNNWHTRGS 263 ++LP PAYQPS LLGA Q PHLEAGFPLRCFQRLSLPNVANQPC W++NWHTRGS Sbjct: 8 TVLPDPAYQPSRLLGALPHQVGGSPHLEAGFPLRCFQRLSLPNVANQPCPWQDNWHTRGS 67 Query: 264 SVPVLSY 284 SVPVLSY Sbjct: 68 SVPVLSY 74 >ref|WP_007385104.1| conserved hypothetical protein, partial [Streptomyces sviceus] gi|297148196|gb|EFH28880.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Streptomyces sviceus ATCC 29083] Length = 70 Score = 110 bits (274), Expect = 3e-22 Identities = 50/61 (81%), Positives = 52/61 (85%) Frame = +3 Query: 90 LPHPAYQPSGLLGASHTQGVWKPHLEAGFPLRCFQRLSLPNVANQPCSWRNNWHTRGSSV 269 LP PAYQPS LLGA QG PHLEAGFPLRCFQRLSLPNVANQPC W++NWHTRGSSV Sbjct: 10 LPDPAYQPSRLLGALTPQGGGSPHLEAGFPLRCFQRLSLPNVANQPCPWQDNWHTRGSSV 69 Query: 270 P 272 P Sbjct: 70 P 70 >ref|WP_009714633.1| hypothetical protein, partial [Streptomyces himastatinicus] gi|302459719|gb|EFL22812.1| LOW QUALITY PROTEIN: hypothetical protein SSOG_02526 [Streptomyces himastatinicus ATCC 53653] Length = 74 Score = 108 bits (270), Expect = 8e-22 Identities = 53/72 (73%), Positives = 57/72 (79%) Frame = +3 Query: 69 STGLQSLLPHPAYQPSGLLGASHTQGVWKPHLEAGFPLRCFQRLSLPNVANQPCSWRNNW 248 ST + LP+ AYQPS LLGA Q PHLEAGFPLRCFQRLSLPNVANQPC W++NW Sbjct: 3 STPPVTRLPYLAYQPSRLLGALTHQVGGSPHLEAGFPLRCFQRLSLPNVANQPCPWQDNW 62 Query: 249 HTRGSSVPVLSY 284 HT GSSVPVLSY Sbjct: 63 HTGGSSVPVLSY 74 >ref|WP_009068222.1| conserved hypothetical protein, partial [Streptomyces sp. SPB78] gi|302430314|gb|EFL02130.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Streptomyces sp. SPB78] Length = 68 Score = 106 bits (265), Expect = 3e-21 Identities = 48/59 (81%), Positives = 51/59 (86%) Frame = +3 Query: 90 LPHPAYQPSGLLGASHTQGVWKPHLEAGFPLRCFQRLSLPNVANQPCSWRNNWHTRGSS 266 LP+PAYQPS LLGA +QG HLEAGFPLRCFQRLSLPNVANQPC W+NNWHTRGSS Sbjct: 10 LPYPAYQPSRLLGALPSQGGGNTHLEAGFPLRCFQRLSLPNVANQPCPWQNNWHTRGSS 68 >ref|WP_006123540.1| conserved hypothetical protein, partial [Streptomyces filamentosus] gi|291346639|gb|EFE73543.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Streptomyces roseosporus NRRL 15998] gi|291348565|gb|EFE75469.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Streptomyces roseosporus NRRL 15998] gi|291348853|gb|EFE75757.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Streptomyces roseosporus NRRL 15998] Length = 50 Score = 90.1 bits (222), Expect = 3e-16 Identities = 39/48 (81%), Positives = 42/48 (87%) Frame = +3 Query: 141 QGVWKPHLEAGFPLRCFQRLSLPNVANQPCSWRNNWHTRGSSVPVLSY 284 +G HLEAGFPLRCFQRLS PNVANQPC W++NWHTRGSSVPVLSY Sbjct: 3 KGGGNTHLEAGFPLRCFQRLSFPNVANQPCPWQDNWHTRGSSVPVLSY 50 >ref|WP_008748712.1| hypothetical protein, partial [Streptomyces sp. SPB74] gi|295827601|gb|EDY46972.2| hypothetical protein SSBG_04935 [Streptomyces sp. SPB74] Length = 77 Score = 87.0 bits (214), Expect = 2e-15 Identities = 42/73 (57%), Positives = 50/73 (68%) Frame = +3 Query: 48 GRLVPVSSTGLQSLLPHPAYQPSGLLGASHTQGVWKPHLEAGFPLRCFQRLSLPNVANQP 227 G+L P ++ + P ++P L G +T HLEAGFPLRCFQRLSLPNVANQP Sbjct: 11 GQLHPSQGFHIRPINPVVYWEPYPLKGGGNT------HLEAGFPLRCFQRLSLPNVANQP 64 Query: 228 CSWRNNWHTRGSS 266 C W+NNWHTRGSS Sbjct: 65 CPWQNNWHTRGSS 77 >ref|WP_008603367.1| cell wall-associated hydrolase, partial [Veillonella sp. 6_1_27] gi|294456247|gb|EFG24611.1| LOW QUALITY PROTEIN: hypothetical protein HMPREF0874_01772, partial [Veillonella sp. 6_1_27] Length = 83 Score = 80.5 bits (197), Expect = 2e-13 Identities = 45/90 (50%), Positives = 53/90 (58%), Gaps = 8/90 (8%) Frame = +3 Query: 39 EVIGRLVPVSSTGLQSLLPHPAYQPSGLLGASHTQGVW--------KPHLEAGFPLRCFQ 194 + + RLVPVSS PH + P G S W KPHL+AGF LRCFQ Sbjct: 4 KALDRLVPVSSN------PHGSSTP----GLSTMSSTWDLTSLCYEKPHLKAGFTLRCFQ 53 Query: 195 RLSLPNVANQPCSWRNNWHTRGSSVPVLSY 284 RLS+PNVA Q W++NW+T GSS PVLSY Sbjct: 54 RLSVPNVATQLYPWQDNWYTSGSSTPVLSY 83 >ref|WP_008715863.1| cell wall-associated hydrolase [Veillonella sp. 3_1_44] gi|294453908|gb|EFG22289.1| hypothetical protein HMPREF0873_01868 [Veillonella sp. 3_1_44] Length = 94 Score = 80.1 bits (196), Expect = 3e-13 Identities = 45/90 (50%), Positives = 53/90 (58%), Gaps = 8/90 (8%) Frame = +3 Query: 39 EVIGRLVPVSSTGLQSLLPHPAYQPSGLLGASHTQGVW--------KPHLEAGFPLRCFQ 194 + + RLVPVSS PH + P G S W KPHL+AGF LRCFQ Sbjct: 15 KALDRLVPVSSK------PHGSSTP----GLSTMSSTWDLTSLRYEKPHLKAGFTLRCFQ 64 Query: 195 RLSLPNVANQPCSWRNNWHTRGSSVPVLSY 284 RLS+PNVA Q W++NW+T GSS PVLSY Sbjct: 65 RLSVPNVATQLYPWQDNWYTSGSSTPVLSY 94 >ref|WP_008715884.1| cell wall-associated hydrolase, partial [Veillonella sp. 3_1_44] gi|294453902|gb|EFG22286.1| LOW QUALITY PROTEIN: hypothetical protein HMPREF0873_01871, partial [Veillonella sp. 3_1_44] Length = 83 Score = 80.1 bits (196), Expect = 3e-13 Identities = 45/90 (50%), Positives = 53/90 (58%), Gaps = 8/90 (8%) Frame = +3 Query: 39 EVIGRLVPVSSTGLQSLLPHPAYQPSGLLGASHTQGVW--------KPHLEAGFPLRCFQ 194 + + RLVPVSS PH + P G S W KPHL+AGF LRCFQ Sbjct: 4 KALDRLVPVSSK------PHGSSTP----GLSTMSSTWDLTSFCYEKPHLKAGFTLRCFQ 53 Query: 195 RLSLPNVANQPCSWRNNWHTRGSSVPVLSY 284 RLS+PNVA Q W++NW+T GSS PVLSY Sbjct: 54 RLSVPNVATQLYPWQDNWYTSGSSTPVLSY 83 >ref|WP_009188945.1| hydrolase [Streptomyces sp. e14] gi|292833023|gb|EFF91372.1| cell wall-associated hydrolase [Streptomyces sp. e14] Length = 122 Score = 74.7 bits (182), Expect = 1e-11 Identities = 38/40 (95%), Positives = 38/40 (95%) Frame = +2 Query: 185 MLSAVIPSERSQPAMLLAEQLAHQRFVRPGPLVLGTALLK 304 MLSAVIP ERSQPAM LAEQLAHQRFVRPGPLVLGTALLK Sbjct: 1 MLSAVIPPERSQPAMPLAEQLAHQRFVRPGPLVLGTALLK 40 >ref|WP_006805144.1| hypothetical protein [Leptotrichia hofstadii] gi|260859524|gb|EEX74024.1| hypothetical protein GCWU000323_01831 [Leptotrichia hofstadii F0254] Length = 48 Score = 74.7 bits (182), Expect = 1e-11 Identities = 31/42 (73%), Positives = 36/42 (85%) Frame = +3 Query: 159 HLEAGFPLRCFQRLSLPNVANQPCSWRNNWHTRGSSVPVLSY 284 HL+AGFPLRCFQRLS+P+V QPC WR+NW+ RG S PVLSY Sbjct: 7 HLKAGFPLRCFQRLSVPDVTTQPCHWRDNWYIRGLSNPVLSY 48 >ref|WP_008749165.1| conserved hypothetical protein, partial [Streptomyces sp. SPB74] gi|295827791|gb|EFG65599.1| conserved hypothetical protein [Streptomyces sp. SPB74] Length = 54 Score = 72.8 bits (177), Expect = 5e-11 Identities = 37/39 (94%), Positives = 37/39 (94%) Frame = +2 Query: 185 MLSAVIPSERSQPAMLLAEQLAHQRFVRPGPLVLGTALL 301 MLSAVIP ERSQPAM LAEQLAHQRFVRPGPLVLGTALL Sbjct: 1 MLSAVIPPERSQPAMPLAEQLAHQRFVRPGPLVLGTALL 39