BLASTX nr result
ID: Paeonia23_contig00011067
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00011067 (301 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002274308.1| PREDICTED: 5' exonuclease Apollo-like [Vitis... 62 6e-08 emb|CAN67061.1| hypothetical protein VITISV_017538 [Vitis vinifera] 62 6e-08 >ref|XP_002274308.1| PREDICTED: 5' exonuclease Apollo-like [Vitis vinifera] Length = 552 Score = 62.4 bits (150), Expect = 6e-08 Identities = 32/59 (54%), Positives = 42/59 (71%), Gaps = 1/59 (1%) Frame = -2 Query: 240 KTFLNLSPPSKRPAVTLFGRARLGLQDSMFVHEEKKT-VTENEPSHIVTTTTEEKISSQ 67 K L+LS PS+RP +TLFG+AR G QDS F HE++KT V +++P IVT E + SSQ Sbjct: 408 KEQLDLSTPSERPPLTLFGKARFGFQDSTFQHEQEKTMVMKSDPQQIVTNRAENESSSQ 466 >emb|CAN67061.1| hypothetical protein VITISV_017538 [Vitis vinifera] Length = 1066 Score = 62.4 bits (150), Expect = 6e-08 Identities = 32/59 (54%), Positives = 42/59 (71%), Gaps = 1/59 (1%) Frame = -2 Query: 240 KTFLNLSPPSKRPAVTLFGRARLGLQDSMFVHEEKKT-VTENEPSHIVTTTTEEKISSQ 67 K L+LS PS+RP +TLFG+AR G QDS F HE++KT V +++P IVT E + SSQ Sbjct: 922 KEQLDLSTPSERPPLTLFGKARFGFQDSTFQHEQEKTMVMKSDPQQIVTNRAENESSSQ 980