BLASTX nr result
ID: Paeonia23_contig00009985
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00009985 (285 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007010774.1| Cysteine proteinase inhibitor 12 [Theobroma ... 139 3e-31 ref|XP_007220532.1| hypothetical protein PRUPE_ppa010412mg [Prun... 137 2e-30 gb|EXB62705.1| Cysteine proteinase inhibitor 12 [Morus notabilis] 136 3e-30 ref|NP_001237734.1| cysteine proteinase inhibitor precursor [Gly... 135 8e-30 gb|ACU24145.1| unknown [Glycine max] 135 8e-30 ref|XP_002525552.1| cysteine protease inhibitor, putative [Ricin... 134 1e-29 emb|CAA89697.1| cysteine proteinase inhibitor [Ricinus communis] 134 1e-29 ref|XP_006471323.1| PREDICTED: cysteine proteinase inhibitor 12-... 134 2e-29 ref|XP_006432368.1| hypothetical protein CICLE_v10002346mg [Citr... 134 2e-29 ref|XP_003565637.1| PREDICTED: cysteine proteinase inhibitor 12-... 133 2e-29 gb|AAM88397.1|AF525880_1 cysteine proteinase inhibitor [Colocasi... 132 4e-29 ref|XP_003633519.1| PREDICTED: cysteine proteinase inhibitor 12-... 132 6e-29 emb|CBI35059.3| unnamed protein product [Vitis vinifera] 132 6e-29 ref|NP_001237443.1| uncharacterized protein LOC100499887 precurs... 132 6e-29 ref|XP_002267841.1| PREDICTED: cysteine proteinase inhibitor 12-... 132 6e-29 gb|ACF49366.1| cystatin, partial [Triticum aestivum] 132 6e-29 ref|XP_003628013.1| Cysteine proteinase inhibitor [Medicago trun... 132 6e-29 dbj|BAE92726.1| multidomain cystatin [Triticum aestivum] gi|3948... 132 6e-29 dbj|BAK03203.1| predicted protein [Hordeum vulgare subsp. vulgare] 131 8e-29 emb|CAG38130.1| cystatin Hv-CPI4 [Hordeum vulgare subsp. vulgare... 131 8e-29 >ref|XP_007010774.1| Cysteine proteinase inhibitor 12 [Theobroma cacao] gi|508727687|gb|EOY19584.1| Cysteine proteinase inhibitor 12 [Theobroma cacao] Length = 239 Score = 139 bits (351), Expect = 3e-31 Identities = 69/87 (79%), Positives = 76/87 (87%), Gaps = 1/87 (1%) Frame = -3 Query: 283 QEVPAHDPVVQDAANHAVKTIQQRSNSLFPYELQEVSHAKAEVIEDFAKFDLLLKVKRGT 104 Q +P HDPVVQDAANHAVKTIQQRSNSL PYEL+E+ HAKAEV+EDFAK D+LLKVKRG Sbjct: 153 QALPTHDPVVQDAANHAVKTIQQRSNSLVPYELKEIVHAKAEVLEDFAKLDMLLKVKRGD 212 Query: 103 KEEKIKVLV-HKNEGVFQLNQMEPDHS 26 KEEK KV V HK+EG F LN+MEPDHS Sbjct: 213 KEEKFKVEVHHKSEGTFHLNRMEPDHS 239 >ref|XP_007220532.1| hypothetical protein PRUPE_ppa010412mg [Prunus persica] gi|462416994|gb|EMJ21731.1| hypothetical protein PRUPE_ppa010412mg [Prunus persica] Length = 250 Score = 137 bits (345), Expect = 2e-30 Identities = 69/87 (79%), Positives = 76/87 (87%), Gaps = 1/87 (1%) Frame = -3 Query: 283 QEVPAHDPVVQDAANHAVKTIQQRSNSLFPYELQEVSHAKAEVIEDFAKFDLLLKVKRGT 104 Q VP HDP VQDAANHAVK++QQRSNSLFPYELQEV HAKAEVIE+ AKF++LLK+KRG Sbjct: 164 QSVPPHDPQVQDAANHAVKSLQQRSNSLFPYELQEVVHAKAEVIEEHAKFNMLLKLKRGD 223 Query: 103 KEEKIKVLVHK-NEGVFQLNQMEPDHS 26 KEEK KV VHK NEG F+LNQME DHS Sbjct: 224 KEEKFKVEVHKNNEGTFKLNQMEADHS 250 >gb|EXB62705.1| Cysteine proteinase inhibitor 12 [Morus notabilis] Length = 239 Score = 136 bits (342), Expect = 3e-30 Identities = 68/87 (78%), Positives = 75/87 (86%), Gaps = 1/87 (1%) Frame = -3 Query: 283 QEVPAHDPVVQDAANHAVKTIQQRSNSLFPYELQEVSHAKAEVIEDFAKFDLLLKVKRGT 104 Q VP HDPVVQDAANHA+ T+QQRSNSLFPYELQEV HAKAEVI++ AKFD++LKVKRGT Sbjct: 153 QVVPTHDPVVQDAANHALSTLQQRSNSLFPYELQEVVHAKAEVIDNSAKFDMILKVKRGT 212 Query: 103 KEEKIKVLVHKN-EGVFQLNQMEPDHS 26 KEEK K VHKN EG F LNQ+EPD S Sbjct: 213 KEEKYKAEVHKNSEGTFHLNQIEPDSS 239 >ref|NP_001237734.1| cysteine proteinase inhibitor precursor [Glycine max] gi|1944319|dbj|BAA19608.1| cysteine proteinase inhibitor [Glycine max] gi|1944342|dbj|BAA19610.1| cysteine proteinase inhibitor [Glycine max] Length = 245 Score = 135 bits (339), Expect = 8e-30 Identities = 69/87 (79%), Positives = 74/87 (85%), Gaps = 1/87 (1%) Frame = -3 Query: 283 QEVPAHDPVVQDAANHAVKTIQQRSNSLFPYELQEVSHAKAEVIEDFAKFDLLLKVKRGT 104 Q VP HDP VQDAANHA+KTIQQRSNSL PYEL EV+ AKAEVI+DFAKF+LLLKVKRG Sbjct: 159 QSVPTHDPQVQDAANHAIKTIQQRSNSLVPYELHEVADAKAEVIDDFAKFNLLLKVKRGQ 218 Query: 103 KEEKIKVLVHK-NEGVFQLNQMEPDHS 26 KEEK KV VHK N+G F LNQME DHS Sbjct: 219 KEEKFKVEVHKNNQGGFHLNQMEQDHS 245 >gb|ACU24145.1| unknown [Glycine max] Length = 245 Score = 135 bits (339), Expect = 8e-30 Identities = 69/87 (79%), Positives = 74/87 (85%), Gaps = 1/87 (1%) Frame = -3 Query: 283 QEVPAHDPVVQDAANHAVKTIQQRSNSLFPYELQEVSHAKAEVIEDFAKFDLLLKVKRGT 104 Q VP HDP VQDAANHA+KTIQQRSNSL PYEL EV+ AKAEVI+DFAKF+LLLKVKRG Sbjct: 159 QSVPTHDPQVQDAANHAIKTIQQRSNSLVPYELHEVADAKAEVIDDFAKFNLLLKVKRGQ 218 Query: 103 KEEKIKVLVHK-NEGVFQLNQMEPDHS 26 KEEK KV VHK N+G F LNQME DHS Sbjct: 219 KEEKFKVEVHKNNQGGFHLNQMEQDHS 245 >ref|XP_002525552.1| cysteine protease inhibitor, putative [Ricinus communis] gi|223535131|gb|EEF36811.1| cysteine protease inhibitor, putative [Ricinus communis] Length = 238 Score = 134 bits (338), Expect = 1e-29 Identities = 66/84 (78%), Positives = 74/84 (88%), Gaps = 1/84 (1%) Frame = -3 Query: 283 QEVPAHDPVVQDAANHAVKTIQQRSNSLFPYELQEVSHAKAEVIEDFAKFDLLLKVKRGT 104 +EV AHDPVVQDAA HAV TIQQRSNSLFPY+LQE+ HAKA+V++DFAKFD++LKVKRGT Sbjct: 153 KEVAAHDPVVQDAATHAVNTIQQRSNSLFPYQLQEIVHAKAQVVDDFAKFDMILKVKRGT 212 Query: 103 KEEKIKVLVHK-NEGVFQLNQMEP 35 EEK KV VHK NEG F LNQMEP Sbjct: 213 SEEKFKVEVHKNNEGTFLLNQMEP 236 >emb|CAA89697.1| cysteine proteinase inhibitor [Ricinus communis] Length = 209 Score = 134 bits (338), Expect = 1e-29 Identities = 66/84 (78%), Positives = 74/84 (88%), Gaps = 1/84 (1%) Frame = -3 Query: 283 QEVPAHDPVVQDAANHAVKTIQQRSNSLFPYELQEVSHAKAEVIEDFAKFDLLLKVKRGT 104 +EV AHDPVVQDAA HAV TIQQRSNSLFPY+LQE+ HAKA+V++DFAKFD++LKVKRGT Sbjct: 124 KEVAAHDPVVQDAATHAVNTIQQRSNSLFPYQLQEIVHAKAQVVDDFAKFDMILKVKRGT 183 Query: 103 KEEKIKVLVHK-NEGVFQLNQMEP 35 EEK KV VHK NEG F LNQMEP Sbjct: 184 SEEKFKVEVHKNNEGTFLLNQMEP 207 >ref|XP_006471323.1| PREDICTED: cysteine proteinase inhibitor 12-like [Citrus sinensis] Length = 235 Score = 134 bits (336), Expect = 2e-29 Identities = 65/84 (77%), Positives = 71/84 (84%) Frame = -3 Query: 283 QEVPAHDPVVQDAANHAVKTIQQRSNSLFPYELQEVSHAKAEVIEDFAKFDLLLKVKRGT 104 Q VP HDP VQDAANHA++TIQQRSNSLFPY LQE+ HAKAEVIEDFAKF +LLKVKRG Sbjct: 150 QAVPVHDPQVQDAANHAIQTIQQRSNSLFPYVLQEIVHAKAEVIEDFAKFAMLLKVKRGE 209 Query: 103 KEEKIKVLVHKNEGVFQLNQMEPD 32 KEEK+ V VHK EG F LNQM+ D Sbjct: 210 KEEKLNVEVHKKEGTFHLNQMQQD 233 >ref|XP_006432368.1| hypothetical protein CICLE_v10002346mg [Citrus clementina] gi|557534490|gb|ESR45608.1| hypothetical protein CICLE_v10002346mg [Citrus clementina] Length = 235 Score = 134 bits (336), Expect = 2e-29 Identities = 65/84 (77%), Positives = 71/84 (84%) Frame = -3 Query: 283 QEVPAHDPVVQDAANHAVKTIQQRSNSLFPYELQEVSHAKAEVIEDFAKFDLLLKVKRGT 104 Q VP HDP VQDAANHA++TIQQRSNSLFPY LQE+ HAKAEVIEDFAKF +LLKVKRG Sbjct: 150 QAVPVHDPQVQDAANHAIQTIQQRSNSLFPYVLQEIVHAKAEVIEDFAKFAMLLKVKRGE 209 Query: 103 KEEKIKVLVHKNEGVFQLNQMEPD 32 KEEK+ V VHK EG F LNQM+ D Sbjct: 210 KEEKLNVEVHKKEGTFHLNQMQQD 233 >ref|XP_003565637.1| PREDICTED: cysteine proteinase inhibitor 12-like [Brachypodium distachyon] Length = 170 Score = 133 bits (335), Expect = 2e-29 Identities = 64/86 (74%), Positives = 77/86 (89%), Gaps = 1/86 (1%) Frame = -3 Query: 283 QEVPAHDPVVQDAANHAVKTIQQRSNSLFPYELQEVSHAKAEVIEDFAKFDLLLKVKRGT 104 ++VP HDPVV++AA+HAVK+IQ+RSNSLFPYEL E+ AKAEV+EDFAKFD+LLK+KRGT Sbjct: 79 RDVPVHDPVVKEAASHAVKSIQERSNSLFPYELLEIIRAKAEVVEDFAKFDILLKLKRGT 138 Query: 103 KEEKIKVLVHKN-EGVFQLNQMEPDH 29 KEEKIK VHKN EG F LNQM+P+H Sbjct: 139 KEEKIKAEVHKNLEGAFVLNQMQPEH 164 >gb|AAM88397.1|AF525880_1 cysteine proteinase inhibitor [Colocasia esculenta] Length = 205 Score = 132 bits (333), Expect = 4e-29 Identities = 65/86 (75%), Positives = 74/86 (86%), Gaps = 1/86 (1%) Frame = -3 Query: 280 EVPAHDPVVQDAANHAVKTIQQRSNSLFPYELQEVSHAKAEVIEDFAKFDLLLKVKRGTK 101 E+P HDPVVQDAANHAVK+IQQRSN+LFPYEL E+ HAKA+V+ED AK LLLK+KRG++ Sbjct: 116 EIPTHDPVVQDAANHAVKSIQQRSNTLFPYELLEILHAKAKVLEDLAKIHLLLKLKRGSR 175 Query: 100 EEKIKVLVHKN-EGVFQLNQMEPDHS 26 EEK KV VHKN EG F LNQME DHS Sbjct: 176 EEKFKVEVHKNIEGTFHLNQMEQDHS 201 >ref|XP_003633519.1| PREDICTED: cysteine proteinase inhibitor 12-like isoform 2 [Vitis vinifera] Length = 188 Score = 132 bits (331), Expect = 6e-29 Identities = 65/87 (74%), Positives = 75/87 (86%), Gaps = 1/87 (1%) Frame = -3 Query: 283 QEVPAHDPVVQDAANHAVKTIQQRSNSLFPYELQEVSHAKAEVIEDFAKFDLLLKVKRGT 104 QEVPAHDP VQ+AANHA+KT+QQRSNS+FP+ELQE+ AKAEV ++ KFD+LLKVKRG Sbjct: 102 QEVPAHDPEVQNAANHAIKTLQQRSNSIFPHELQEILLAKAEVSQNLVKFDMLLKVKRGD 161 Query: 103 KEEKIKVLVHK-NEGVFQLNQMEPDHS 26 KEEK KV VHK NEG +QLNQM PDHS Sbjct: 162 KEEKYKVEVHKNNEGAYQLNQMAPDHS 188 >emb|CBI35059.3| unnamed protein product [Vitis vinifera] Length = 1204 Score = 132 bits (331), Expect = 6e-29 Identities = 65/87 (74%), Positives = 75/87 (86%), Gaps = 1/87 (1%) Frame = -3 Query: 283 QEVPAHDPVVQDAANHAVKTIQQRSNSLFPYELQEVSHAKAEVIEDFAKFDLLLKVKRGT 104 QEVPAHDP VQ+AANHA+KT+QQRSNS+FP+ELQE+ AKAEV ++ KFD+LLKVKRG Sbjct: 1118 QEVPAHDPEVQNAANHAIKTLQQRSNSIFPHELQEILLAKAEVSQNLVKFDMLLKVKRGD 1177 Query: 103 KEEKIKVLVHK-NEGVFQLNQMEPDHS 26 KEEK KV VHK NEG +QLNQM PDHS Sbjct: 1178 KEEKYKVEVHKNNEGAYQLNQMAPDHS 1204 >ref|NP_001237443.1| uncharacterized protein LOC100499887 precursor [Glycine max] gi|255627437|gb|ACU14063.1| unknown [Glycine max] Length = 245 Score = 132 bits (331), Expect = 6e-29 Identities = 68/87 (78%), Positives = 73/87 (83%), Gaps = 1/87 (1%) Frame = -3 Query: 283 QEVPAHDPVVQDAANHAVKTIQQRSNSLFPYELQEVSHAKAEVIEDFAKFDLLLKVKRGT 104 Q VP HDP VQDAANHA+KTIQQRSNSL PYEL EV+ AKAEVI+DFAKF+LLLKVKRG Sbjct: 159 QSVPTHDPQVQDAANHAIKTIQQRSNSLVPYELHEVADAKAEVIDDFAKFNLLLKVKRGQ 218 Query: 103 KEEKIKVLVHK-NEGVFQLNQMEPDHS 26 KEEK KV VHK N+ F LNQME DHS Sbjct: 219 KEEKFKVEVHKNNQRGFHLNQMEQDHS 245 >ref|XP_002267841.1| PREDICTED: cysteine proteinase inhibitor 12-like isoform 1 [Vitis vinifera] Length = 201 Score = 132 bits (331), Expect = 6e-29 Identities = 65/87 (74%), Positives = 75/87 (86%), Gaps = 1/87 (1%) Frame = -3 Query: 283 QEVPAHDPVVQDAANHAVKTIQQRSNSLFPYELQEVSHAKAEVIEDFAKFDLLLKVKRGT 104 QEVPAHDP VQ+AANHA+KT+QQRSNS+FP+ELQE+ AKAEV ++ KFD+LLKVKRG Sbjct: 115 QEVPAHDPEVQNAANHAIKTLQQRSNSIFPHELQEILLAKAEVSQNLVKFDMLLKVKRGD 174 Query: 103 KEEKIKVLVHK-NEGVFQLNQMEPDHS 26 KEEK KV VHK NEG +QLNQM PDHS Sbjct: 175 KEEKYKVEVHKNNEGAYQLNQMAPDHS 201 >gb|ACF49366.1| cystatin, partial [Triticum aestivum] Length = 243 Score = 132 bits (331), Expect = 6e-29 Identities = 63/86 (73%), Positives = 76/86 (88%), Gaps = 1/86 (1%) Frame = -3 Query: 283 QEVPAHDPVVQDAANHAVKTIQQRSNSLFPYELQEVSHAKAEVIEDFAKFDLLLKVKRGT 104 ++VP HDPVV+DAA+HAVK+IQQRSNSL PYEL E+ AKAEV+EDFAKFD+L+K+KRGT Sbjct: 152 RDVPVHDPVVKDAASHAVKSIQQRSNSLLPYELVEIVRAKAEVVEDFAKFDILMKLKRGT 211 Query: 103 KEEKIKVLVHKN-EGVFQLNQMEPDH 29 KEEK+K VHKN EG F LNQM+P+H Sbjct: 212 KEEKMKAEVHKNLEGAFVLNQMQPEH 237 >ref|XP_003628013.1| Cysteine proteinase inhibitor [Medicago truncatula] gi|355522035|gb|AET02489.1| Cysteine proteinase inhibitor [Medicago truncatula] Length = 241 Score = 132 bits (331), Expect = 6e-29 Identities = 69/87 (79%), Positives = 74/87 (85%), Gaps = 1/87 (1%) Frame = -3 Query: 283 QEVPAHDPVVQDAANHAVKTIQQRSNSLFPYELQEVSHAKAEVIEDFAKFDLLLKVKRGT 104 Q VPAHDP VQDAANHA+KTIQQRSNSL PYEL EV+ AKAEVI+D AKF+LLLKVKRG Sbjct: 155 QSVPAHDPQVQDAANHAIKTIQQRSNSLVPYELHEVTDAKAEVIDDTAKFNLLLKVKRGQ 214 Query: 103 KEEKIKVLVHKN-EGVFQLNQMEPDHS 26 KEEK KV VHKN EG F LNQME D+S Sbjct: 215 KEEKFKVEVHKNSEGNFHLNQMEADNS 241 >dbj|BAE92726.1| multidomain cystatin [Triticum aestivum] gi|394848424|gb|AFN42325.1| cysteine proteinase inhibitor [Secale cereale x Triticum aestivum] Length = 243 Score = 132 bits (331), Expect = 6e-29 Identities = 63/86 (73%), Positives = 76/86 (88%), Gaps = 1/86 (1%) Frame = -3 Query: 283 QEVPAHDPVVQDAANHAVKTIQQRSNSLFPYELQEVSHAKAEVIEDFAKFDLLLKVKRGT 104 ++VP HDPVV+DAA+HAVK+IQQRSNSL PYEL E+ AKAEV+EDFAKFD+L+K+KRGT Sbjct: 152 RDVPVHDPVVKDAASHAVKSIQQRSNSLLPYELVEIVRAKAEVVEDFAKFDILMKLKRGT 211 Query: 103 KEEKIKVLVHKN-EGVFQLNQMEPDH 29 KEEK+K VHKN EG F LNQM+P+H Sbjct: 212 KEEKMKAEVHKNLEGAFVLNQMQPEH 237 >dbj|BAK03203.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 242 Score = 131 bits (330), Expect = 8e-29 Identities = 62/86 (72%), Positives = 77/86 (89%), Gaps = 1/86 (1%) Frame = -3 Query: 283 QEVPAHDPVVQDAANHAVKTIQQRSNSLFPYELQEVSHAKAEVIEDFAKFDLLLKVKRGT 104 ++VP HDPVV+DAA+HAVK+IQ+RSNSLFPYEL E+ AKAEV+EDFAKFD+++K+KRGT Sbjct: 151 RDVPVHDPVVKDAASHAVKSIQERSNSLFPYELIEIVRAKAEVVEDFAKFDIVMKLKRGT 210 Query: 103 KEEKIKVLVHKN-EGVFQLNQMEPDH 29 KEEK+K VHKN EG F LNQM+P+H Sbjct: 211 KEEKMKAEVHKNLEGAFVLNQMQPEH 236 >emb|CAG38130.1| cystatin Hv-CPI4 [Hordeum vulgare subsp. vulgare] gi|326505198|dbj|BAK02986.1| predicted protein [Hordeum vulgare subsp. vulgare] gi|326519388|dbj|BAJ96693.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 243 Score = 131 bits (330), Expect = 8e-29 Identities = 62/86 (72%), Positives = 77/86 (89%), Gaps = 1/86 (1%) Frame = -3 Query: 283 QEVPAHDPVVQDAANHAVKTIQQRSNSLFPYELQEVSHAKAEVIEDFAKFDLLLKVKRGT 104 ++VP HDPVV+DAA+HAVK+IQ+RSNSLFPYEL E+ AKAEV+EDFAKFD+++K+KRGT Sbjct: 152 RDVPVHDPVVKDAASHAVKSIQERSNSLFPYELIEIVRAKAEVVEDFAKFDIVMKLKRGT 211 Query: 103 KEEKIKVLVHKN-EGVFQLNQMEPDH 29 KEEK+K VHKN EG F LNQM+P+H Sbjct: 212 KEEKMKAEVHKNLEGAFVLNQMQPEH 237