BLASTX nr result
ID: Paeonia23_contig00009790
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00009790 (223 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007213914.1| hypothetical protein PRUPE_ppa005669mg [Prun... 78 1e-12 gb|EXB56751.1| Phosphoglycerate kinase [Morus notabilis] 75 7e-12 gb|AFK46712.1| unknown [Medicago truncatula] 75 7e-12 gb|ACJ84593.1| unknown [Medicago truncatula] 75 7e-12 ref|XP_003596092.1| Phosphoglycerate kinase [Medicago truncatula... 75 7e-12 ref|XP_006389877.1| hypothetical protein EUTSA_v10018657mg [Eutr... 74 2e-11 ref|XP_006300323.1| hypothetical protein CARUB_v10020404mg [Caps... 74 2e-11 gb|AAF85975.1|AF275639_1 cytosolic phosphoglycerate kinase [Pisu... 74 2e-11 ref|NP_178073.1| phosphoglycerate kinase [Arabidopsis thaliana] ... 74 2e-11 gb|AFW70281.1| phosphoglycerate kinase [Zea mays] 74 2e-11 ref|XP_002889253.1| hypothetical protein ARALYDRAFT_477124 [Arab... 74 2e-11 gb|AAM61185.1| phosphoglycerate kinase, putative [Arabidopsis th... 74 2e-11 ref|XP_004488762.1| PREDICTED: phosphoglycerate kinase, cytosoli... 74 2e-11 ref|XP_003596093.1| Phosphoglycerate kinase [Medicago truncatula... 74 2e-11 sp|P12783.1|PGKY_WHEAT RecName: Full=Phosphoglycerate kinase, cy... 73 5e-11 ref|XP_007149209.1| hypothetical protein PHAVU_005G050800g [Phas... 73 5e-11 gb|EMT29203.1| Phosphoglycerate kinase, cytosolic [Aegilops taus... 73 5e-11 gb|EMS46092.1| Phosphoglycerate kinase, cytosolic [Triticum urartu] 73 5e-11 ref|XP_004139837.1| PREDICTED: phosphoglycerate kinase, cytosoli... 73 5e-11 gb|AFW70285.1| hypothetical protein ZEAMMB73_319281 [Zea mays] 73 5e-11 >ref|XP_007213914.1| hypothetical protein PRUPE_ppa005669mg [Prunus persica] gi|462409779|gb|EMJ15113.1| hypothetical protein PRUPE_ppa005669mg [Prunus persica] Length = 449 Score = 77.8 bits (190), Expect = 1e-12 Identities = 48/80 (60%), Positives = 53/80 (66%), Gaps = 8/80 (10%) Frame = +1 Query: 7 RLYKPSHPSLSSIFASLLSNKASPNRSSQ*I--------VMATKRSVGTLKEAELKGKKV 162 R PS PS SS S +S+ + + S VMATKRSV TLKEAELKGK+V Sbjct: 10 RAVSPS-PSQSSCLCSSISHSITHHIFSDLCHCTFFAVTVMATKRSVSTLKEAELKGKRV 68 Query: 163 FVRVDLNVPLDDNQKITDDT 222 FVRVDLNVPLDDN KITDDT Sbjct: 69 FVRVDLNVPLDDNSKITDDT 88 >gb|EXB56751.1| Phosphoglycerate kinase [Morus notabilis] Length = 401 Score = 75.5 bits (184), Expect = 7e-12 Identities = 37/40 (92%), Positives = 38/40 (95%) Frame = +1 Query: 103 MATKRSVGTLKEAELKGKKVFVRVDLNVPLDDNQKITDDT 222 MATKRSVGTLKEAELKGK+VFVRVDLNVPLDDN ITDDT Sbjct: 1 MATKRSVGTLKEAELKGKRVFVRVDLNVPLDDNLNITDDT 40 >gb|AFK46712.1| unknown [Medicago truncatula] Length = 401 Score = 75.5 bits (184), Expect = 7e-12 Identities = 37/40 (92%), Positives = 38/40 (95%) Frame = +1 Query: 103 MATKRSVGTLKEAELKGKKVFVRVDLNVPLDDNQKITDDT 222 MATKRSVGTLKEAELKGK+VFVRVDLNVPLDDN ITDDT Sbjct: 1 MATKRSVGTLKEAELKGKRVFVRVDLNVPLDDNLNITDDT 40 >gb|ACJ84593.1| unknown [Medicago truncatula] Length = 226 Score = 75.5 bits (184), Expect = 7e-12 Identities = 37/40 (92%), Positives = 38/40 (95%) Frame = +1 Query: 103 MATKRSVGTLKEAELKGKKVFVRVDLNVPLDDNQKITDDT 222 MATKRSVGTLKEAELKGK+VFVRVDLNVPLDDN ITDDT Sbjct: 1 MATKRSVGTLKEAELKGKRVFVRVDLNVPLDDNLNITDDT 40 >ref|XP_003596092.1| Phosphoglycerate kinase [Medicago truncatula] gi|355485140|gb|AES66343.1| Phosphoglycerate kinase [Medicago truncatula] Length = 401 Score = 75.5 bits (184), Expect = 7e-12 Identities = 37/40 (92%), Positives = 38/40 (95%) Frame = +1 Query: 103 MATKRSVGTLKEAELKGKKVFVRVDLNVPLDDNQKITDDT 222 MATKRSVGTLKEAELKGK+VFVRVDLNVPLDDN ITDDT Sbjct: 1 MATKRSVGTLKEAELKGKRVFVRVDLNVPLDDNLNITDDT 40 >ref|XP_006389877.1| hypothetical protein EUTSA_v10018657mg [Eutrema salsugineum] gi|557086311|gb|ESQ27163.1| hypothetical protein EUTSA_v10018657mg [Eutrema salsugineum] Length = 401 Score = 74.3 bits (181), Expect = 2e-11 Identities = 36/40 (90%), Positives = 37/40 (92%) Frame = +1 Query: 103 MATKRSVGTLKEAELKGKKVFVRVDLNVPLDDNQKITDDT 222 MATKRSVGTLKEA+LKGK VFVRVDLNVPLDDN ITDDT Sbjct: 1 MATKRSVGTLKEADLKGKSVFVRVDLNVPLDDNSNITDDT 40 >ref|XP_006300323.1| hypothetical protein CARUB_v10020404mg [Capsella rubella] gi|565485369|ref|XP_006300324.1| hypothetical protein CARUB_v10020404mg [Capsella rubella] gi|482569033|gb|EOA33221.1| hypothetical protein CARUB_v10020404mg [Capsella rubella] gi|482569034|gb|EOA33222.1| hypothetical protein CARUB_v10020404mg [Capsella rubella] Length = 401 Score = 74.3 bits (181), Expect = 2e-11 Identities = 36/40 (90%), Positives = 37/40 (92%) Frame = +1 Query: 103 MATKRSVGTLKEAELKGKKVFVRVDLNVPLDDNQKITDDT 222 MATKRSVGTLKEA+LKGK VFVRVDLNVPLDDN ITDDT Sbjct: 1 MATKRSVGTLKEADLKGKSVFVRVDLNVPLDDNSNITDDT 40 >gb|AAF85975.1|AF275639_1 cytosolic phosphoglycerate kinase [Pisum sativum] Length = 401 Score = 74.3 bits (181), Expect = 2e-11 Identities = 36/40 (90%), Positives = 38/40 (95%) Frame = +1 Query: 103 MATKRSVGTLKEAELKGKKVFVRVDLNVPLDDNQKITDDT 222 MATKRSVGTLKEA+LKGK+VFVRVDLNVPLDDN ITDDT Sbjct: 1 MATKRSVGTLKEADLKGKRVFVRVDLNVPLDDNLNITDDT 40 >ref|NP_178073.1| phosphoglycerate kinase [Arabidopsis thaliana] gi|30699430|ref|NP_849907.1| phosphoglycerate kinase [Arabidopsis thaliana] gi|4835754|gb|AAD30221.1|AC007202_3 Is a member of the PF|00162 Phosphoglycerate kinase family. ESTs gb|N38721, gb|T22178, gb|R90345, gb|R90715, gb|T21140, gb|T46295, gb|H37082, gb|T46076, gb|N37132, gb|AA597649, gb|AI100648 and gb|Z48462 come from this gene [Arabidopsis thaliana] gi|7839393|gb|AAF70260.1|AF247560_1 cytosolic phosphoglycerate kinase [Arabidopsis thaliana] gi|13194782|gb|AAK15553.1|AF348582_1 putative phosphoglycerate kinase [Arabidopsis thaliana] gi|17065574|gb|AAL32941.1| Unknown protein [Arabidopsis thaliana] gi|30725646|gb|AAP37845.1| At1g79550 [Arabidopsis thaliana] gi|332198141|gb|AEE36262.1| phosphoglycerate kinase [Arabidopsis thaliana] gi|332198142|gb|AEE36263.1| phosphoglycerate kinase [Arabidopsis thaliana] Length = 401 Score = 74.3 bits (181), Expect = 2e-11 Identities = 36/40 (90%), Positives = 37/40 (92%) Frame = +1 Query: 103 MATKRSVGTLKEAELKGKKVFVRVDLNVPLDDNQKITDDT 222 MATKRSVGTLKEA+LKGK VFVRVDLNVPLDDN ITDDT Sbjct: 1 MATKRSVGTLKEADLKGKSVFVRVDLNVPLDDNSNITDDT 40 >gb|AFW70281.1| phosphoglycerate kinase [Zea mays] Length = 572 Score = 74.3 bits (181), Expect = 2e-11 Identities = 37/41 (90%), Positives = 38/41 (92%) Frame = +1 Query: 100 VMATKRSVGTLKEAELKGKKVFVRVDLNVPLDDNQKITDDT 222 VMATKRSVGTL EA+LKGKKVFVR DLNVPLDD QKITDDT Sbjct: 170 VMATKRSVGTLGEADLKGKKVFVRADLNVPLDDAQKITDDT 210 >ref|XP_002889253.1| hypothetical protein ARALYDRAFT_477124 [Arabidopsis lyrata subsp. lyrata] gi|297335094|gb|EFH65512.1| hypothetical protein ARALYDRAFT_477124 [Arabidopsis lyrata subsp. lyrata] Length = 401 Score = 74.3 bits (181), Expect = 2e-11 Identities = 36/40 (90%), Positives = 37/40 (92%) Frame = +1 Query: 103 MATKRSVGTLKEAELKGKKVFVRVDLNVPLDDNQKITDDT 222 MATKRSVGTLKEA+LKGK VFVRVDLNVPLDDN ITDDT Sbjct: 1 MATKRSVGTLKEADLKGKSVFVRVDLNVPLDDNSNITDDT 40 >gb|AAM61185.1| phosphoglycerate kinase, putative [Arabidopsis thaliana] Length = 401 Score = 74.3 bits (181), Expect = 2e-11 Identities = 36/40 (90%), Positives = 37/40 (92%) Frame = +1 Query: 103 MATKRSVGTLKEAELKGKKVFVRVDLNVPLDDNQKITDDT 222 MATKRSVGTLKEA+LKGK VFVRVDLNVPLDDN ITDDT Sbjct: 1 MATKRSVGTLKEADLKGKSVFVRVDLNVPLDDNSNITDDT 40 >ref|XP_004488762.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Cicer arietinum] Length = 401 Score = 73.9 bits (180), Expect = 2e-11 Identities = 36/40 (90%), Positives = 37/40 (92%) Frame = +1 Query: 103 MATKRSVGTLKEAELKGKKVFVRVDLNVPLDDNQKITDDT 222 MATKRSVGTLKE +LKGKKVFVRVDLNVPLDDN ITDDT Sbjct: 1 MATKRSVGTLKEGDLKGKKVFVRVDLNVPLDDNLNITDDT 40 >ref|XP_003596093.1| Phosphoglycerate kinase [Medicago truncatula] gi|355485141|gb|AES66344.1| Phosphoglycerate kinase [Medicago truncatula] Length = 401 Score = 73.9 bits (180), Expect = 2e-11 Identities = 36/40 (90%), Positives = 37/40 (92%) Frame = +1 Query: 103 MATKRSVGTLKEAELKGKKVFVRVDLNVPLDDNQKITDDT 222 MATKRSVGTLKE ELKGK+VFVRVDLNVPLDDN ITDDT Sbjct: 1 MATKRSVGTLKEGELKGKRVFVRVDLNVPLDDNLNITDDT 40 >sp|P12783.1|PGKY_WHEAT RecName: Full=Phosphoglycerate kinase, cytosolic gi|21835|emb|CAA33302.1| unnamed protein product [Triticum aestivum] Length = 401 Score = 72.8 bits (177), Expect = 5e-11 Identities = 36/40 (90%), Positives = 37/40 (92%) Frame = +1 Query: 103 MATKRSVGTLKEAELKGKKVFVRVDLNVPLDDNQKITDDT 222 MATKRSVGTL EA+LKGKKVFVR DLNVPLDD QKITDDT Sbjct: 1 MATKRSVGTLGEADLKGKKVFVRADLNVPLDDAQKITDDT 40 >ref|XP_007149209.1| hypothetical protein PHAVU_005G050800g [Phaseolus vulgaris] gi|593697474|ref|XP_007149210.1| hypothetical protein PHAVU_005G050800g [Phaseolus vulgaris] gi|561022473|gb|ESW21203.1| hypothetical protein PHAVU_005G050800g [Phaseolus vulgaris] gi|561022474|gb|ESW21204.1| hypothetical protein PHAVU_005G050800g [Phaseolus vulgaris] Length = 401 Score = 72.8 bits (177), Expect = 5e-11 Identities = 35/40 (87%), Positives = 37/40 (92%) Frame = +1 Query: 103 MATKRSVGTLKEAELKGKKVFVRVDLNVPLDDNQKITDDT 222 MATKRSVGTLKE +LKGK+VFVRVDLNVPLDDN ITDDT Sbjct: 1 MATKRSVGTLKEGDLKGKRVFVRVDLNVPLDDNLNITDDT 40 >gb|EMT29203.1| Phosphoglycerate kinase, cytosolic [Aegilops tauschii] Length = 494 Score = 72.8 bits (177), Expect = 5e-11 Identities = 36/40 (90%), Positives = 37/40 (92%) Frame = +1 Query: 103 MATKRSVGTLKEAELKGKKVFVRVDLNVPLDDNQKITDDT 222 MATKRSVGTL EA+LKGKKVFVR DLNVPLDD QKITDDT Sbjct: 1 MATKRSVGTLGEADLKGKKVFVRADLNVPLDDAQKITDDT 40 >gb|EMS46092.1| Phosphoglycerate kinase, cytosolic [Triticum urartu] Length = 429 Score = 72.8 bits (177), Expect = 5e-11 Identities = 36/40 (90%), Positives = 37/40 (92%) Frame = +1 Query: 103 MATKRSVGTLKEAELKGKKVFVRVDLNVPLDDNQKITDDT 222 MATKRSVGTL EA+LKGKKVFVR DLNVPLDD QKITDDT Sbjct: 1 MATKRSVGTLGEADLKGKKVFVRADLNVPLDDAQKITDDT 40 >ref|XP_004139837.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Cucumis sativus] gi|449493000|ref|XP_004159164.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Cucumis sativus] Length = 401 Score = 72.8 bits (177), Expect = 5e-11 Identities = 35/40 (87%), Positives = 38/40 (95%) Frame = +1 Query: 103 MATKRSVGTLKEAELKGKKVFVRVDLNVPLDDNQKITDDT 222 MATK+SVGTLKEA+LKGK+VFVRVDLNVPLDDN ITDDT Sbjct: 1 MATKKSVGTLKEADLKGKRVFVRVDLNVPLDDNFNITDDT 40 >gb|AFW70285.1| hypothetical protein ZEAMMB73_319281 [Zea mays] Length = 186 Score = 72.8 bits (177), Expect = 5e-11 Identities = 36/40 (90%), Positives = 37/40 (92%) Frame = +1 Query: 103 MATKRSVGTLKEAELKGKKVFVRVDLNVPLDDNQKITDDT 222 MATKRSVGTL EA+LKGKKVFVR DLNVPLDD QKITDDT Sbjct: 1 MATKRSVGTLGEADLKGKKVFVRADLNVPLDDAQKITDDT 40