BLASTX nr result
ID: Paeonia23_contig00008585
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00008585 (443 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004152023.1| PREDICTED: putative vesicle-associated membr... 65 1e-08 ref|XP_007034425.1| Vesicle-associated membrane protein 726 isof... 64 2e-08 ref|XP_004296647.1| PREDICTED: putative vesicle-associated membr... 64 3e-08 ref|XP_002304708.1| synptobrevin-related family protein [Populus... 64 3e-08 ref|XP_007140570.1| hypothetical protein PHAVU_008G123800g [Phas... 63 5e-08 ref|XP_006443628.1| hypothetical protein CICLE_v10022162mg [Citr... 63 5e-08 ref|XP_007140571.1| hypothetical protein PHAVU_008G123800g [Phas... 63 5e-08 ref|XP_004290222.1| PREDICTED: putative vesicle-associated membr... 63 5e-08 ref|XP_003532299.1| PREDICTED: vesicle-associated membrane prote... 63 5e-08 ref|NP_001241434.1| uncharacterized protein LOC100804314 [Glycin... 63 5e-08 ref|XP_006420620.1| hypothetical protein CICLE_v10005852mg [Citr... 62 8e-08 ref|XP_002297816.2| hypothetical protein POPTR_0001s14430g [Popu... 62 8e-08 ref|XP_007034424.1| Vesicle-associated membrane protein 726 isof... 62 8e-08 ref|XP_004134008.1| PREDICTED: putative vesicle-associated membr... 62 8e-08 ref|XP_002518125.1| Vesicle-associated membrane protein, putativ... 62 8e-08 ref|XP_002264270.1| PREDICTED: putative vesicle-associated membr... 62 8e-08 ref|XP_002267063.1| PREDICTED: putative vesicle-associated membr... 62 8e-08 emb|CAN65946.1| hypothetical protein VITISV_029427 [Vitis vinifera] 62 8e-08 ref|XP_003622969.1| Vesicle-associated membrane protein [Medicag... 61 1e-07 gb|EPS70718.1| hypothetical protein M569_04041 [Genlisea aurea] 61 2e-07 >ref|XP_004152023.1| PREDICTED: putative vesicle-associated membrane protein 726-like [Cucumis sativus] gi|449524754|ref|XP_004169386.1| PREDICTED: putative vesicle-associated membrane protein 726-like [Cucumis sativus] Length = 219 Score = 64.7 bits (156), Expect = 1e-08 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -1 Query: 443 TENLRSQAQDFRQQGTKMRRKMWFQNMKMK 354 TENLRSQAQDFRQQGTKMRRKMW+QNMKMK Sbjct: 166 TENLRSQAQDFRQQGTKMRRKMWYQNMKMK 195 >ref|XP_007034425.1| Vesicle-associated membrane protein 726 isoform 2 [Theobroma cacao] gi|508713454|gb|EOY05351.1| Vesicle-associated membrane protein 726 isoform 2 [Theobroma cacao] Length = 219 Score = 64.3 bits (155), Expect = 2e-08 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -1 Query: 443 TENLRSQAQDFRQQGTKMRRKMWFQNMKMK 354 TENLRSQAQDFRQQGTKMRRKMWFQNMK+K Sbjct: 166 TENLRSQAQDFRQQGTKMRRKMWFQNMKIK 195 >ref|XP_004296647.1| PREDICTED: putative vesicle-associated membrane protein 726-like [Fragaria vesca subsp. vesca] Length = 222 Score = 63.5 bits (153), Expect = 3e-08 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -1 Query: 443 TENLRSQAQDFRQQGTKMRRKMWFQNMKMK 354 T+NLRSQAQDF+QQGTKMRRKMWFQNMKMK Sbjct: 166 TDNLRSQAQDFKQQGTKMRRKMWFQNMKMK 195 >ref|XP_002304708.1| synptobrevin-related family protein [Populus trichocarpa] gi|222842140|gb|EEE79687.1| synptobrevin-related family protein [Populus trichocarpa] Length = 219 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -1 Query: 443 TENLRSQAQDFRQQGTKMRRKMWFQNMKMK 354 TENLRSQAQDFRQQGTKMRRKMW QNMKMK Sbjct: 166 TENLRSQAQDFRQQGTKMRRKMWIQNMKMK 195 >ref|XP_007140570.1| hypothetical protein PHAVU_008G123800g [Phaseolus vulgaris] gi|561013703|gb|ESW12564.1| hypothetical protein PHAVU_008G123800g [Phaseolus vulgaris] Length = 164 Score = 62.8 bits (151), Expect = 5e-08 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -1 Query: 443 TENLRSQAQDFRQQGTKMRRKMWFQNMKMK 354 TENLRSQAQDFRQQGTK+RRKMWFQNMK+K Sbjct: 109 TENLRSQAQDFRQQGTKIRRKMWFQNMKIK 138 >ref|XP_006443628.1| hypothetical protein CICLE_v10022162mg [Citrus clementina] gi|568851259|ref|XP_006479311.1| PREDICTED: vesicle-associated membrane protein 722-like [Citrus sinensis] gi|557545890|gb|ESR56868.1| hypothetical protein CICLE_v10022162mg [Citrus clementina] Length = 219 Score = 62.8 bits (151), Expect = 5e-08 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -1 Query: 443 TENLRSQAQDFRQQGTKMRRKMWFQNMKMK 354 TENLRSQAQDFRQQGT+MRRKMWFQNMK+K Sbjct: 166 TENLRSQAQDFRQQGTQMRRKMWFQNMKIK 195 >ref|XP_007140571.1| hypothetical protein PHAVU_008G123800g [Phaseolus vulgaris] gi|543176432|gb|AGV54239.1| vesicle-associated membrane protein [Phaseolus vulgaris] gi|561013704|gb|ESW12565.1| hypothetical protein PHAVU_008G123800g [Phaseolus vulgaris] Length = 221 Score = 62.8 bits (151), Expect = 5e-08 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -1 Query: 443 TENLRSQAQDFRQQGTKMRRKMWFQNMKMK 354 TENLRSQAQDFRQQGTK+RRKMWFQNMK+K Sbjct: 166 TENLRSQAQDFRQQGTKIRRKMWFQNMKIK 195 >ref|XP_004290222.1| PREDICTED: putative vesicle-associated membrane protein 726-like [Fragaria vesca subsp. vesca] Length = 219 Score = 62.8 bits (151), Expect = 5e-08 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -1 Query: 443 TENLRSQAQDFRQQGTKMRRKMWFQNMKMK 354 TENLRSQAQDFRQQGT+MRRKMWFQNMK+K Sbjct: 166 TENLRSQAQDFRQQGTQMRRKMWFQNMKIK 195 >ref|XP_003532299.1| PREDICTED: vesicle-associated membrane protein 722-like [Glycine max] Length = 221 Score = 62.8 bits (151), Expect = 5e-08 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -1 Query: 443 TENLRSQAQDFRQQGTKMRRKMWFQNMKMK 354 TENLRSQAQDFRQQGTK+RRKMWFQNMK+K Sbjct: 166 TENLRSQAQDFRQQGTKIRRKMWFQNMKIK 195 >ref|NP_001241434.1| uncharacterized protein LOC100804314 [Glycine max] gi|255648379|gb|ACU24640.1| unknown [Glycine max] Length = 221 Score = 62.8 bits (151), Expect = 5e-08 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -1 Query: 443 TENLRSQAQDFRQQGTKMRRKMWFQNMKMK 354 TENLRSQAQDFRQQGTK+RRKMWFQNMK+K Sbjct: 166 TENLRSQAQDFRQQGTKIRRKMWFQNMKIK 195 >ref|XP_006420620.1| hypothetical protein CICLE_v10005852mg [Citrus clementina] gi|567855003|ref|XP_006420621.1| hypothetical protein CICLE_v10005852mg [Citrus clementina] gi|568873303|ref|XP_006489783.1| PREDICTED: putative vesicle-associated membrane protein 726-like [Citrus sinensis] gi|557522493|gb|ESR33860.1| hypothetical protein CICLE_v10005852mg [Citrus clementina] gi|557522494|gb|ESR33861.1| hypothetical protein CICLE_v10005852mg [Citrus clementina] Length = 219 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -1 Query: 443 TENLRSQAQDFRQQGTKMRRKMWFQNMKMK 354 TENLRSQAQDFRQQGTKMRRKMW QNMK+K Sbjct: 166 TENLRSQAQDFRQQGTKMRRKMWIQNMKIK 195 >ref|XP_002297816.2| hypothetical protein POPTR_0001s14430g [Populus trichocarpa] gi|550347240|gb|EEE82621.2| hypothetical protein POPTR_0001s14430g [Populus trichocarpa] Length = 219 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -1 Query: 443 TENLRSQAQDFRQQGTKMRRKMWFQNMKMK 354 TENLRSQAQDFRQQGTKMRRKMW QNMK+K Sbjct: 166 TENLRSQAQDFRQQGTKMRRKMWIQNMKIK 195 >ref|XP_007034424.1| Vesicle-associated membrane protein 726 isoform 1 [Theobroma cacao] gi|508713453|gb|EOY05350.1| Vesicle-associated membrane protein 726 isoform 1 [Theobroma cacao] Length = 219 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -1 Query: 443 TENLRSQAQDFRQQGTKMRRKMWFQNMKMK 354 TENLRSQAQDFRQQGTKMRRKMW QNMK+K Sbjct: 166 TENLRSQAQDFRQQGTKMRRKMWLQNMKIK 195 >ref|XP_004134008.1| PREDICTED: putative vesicle-associated membrane protein 726-like [Cucumis sativus] gi|449487534|ref|XP_004157674.1| PREDICTED: putative vesicle-associated membrane protein 726-like [Cucumis sativus] Length = 219 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -1 Query: 443 TENLRSQAQDFRQQGTKMRRKMWFQNMKMK 354 TENLRSQAQDFR QGTKMRRKMWFQNMK+K Sbjct: 166 TENLRSQAQDFRTQGTKMRRKMWFQNMKIK 195 >ref|XP_002518125.1| Vesicle-associated membrane protein, putative [Ricinus communis] gi|223542721|gb|EEF44258.1| Vesicle-associated membrane protein, putative [Ricinus communis] Length = 219 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -1 Query: 443 TENLRSQAQDFRQQGTKMRRKMWFQNMKMK 354 TENLRSQAQDFRQQGTKMRRKMW QNMK+K Sbjct: 166 TENLRSQAQDFRQQGTKMRRKMWIQNMKIK 195 >ref|XP_002264270.1| PREDICTED: putative vesicle-associated membrane protein 726 [Vitis vinifera] gi|296090506|emb|CBI40837.3| unnamed protein product [Vitis vinifera] Length = 220 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -1 Query: 443 TENLRSQAQDFRQQGTKMRRKMWFQNMKMK 354 TENLRSQAQDFRQQGTKMRRKMW QNMK+K Sbjct: 167 TENLRSQAQDFRQQGTKMRRKMWMQNMKIK 196 >ref|XP_002267063.1| PREDICTED: putative vesicle-associated membrane protein 726 isoform 1 [Vitis vinifera] gi|297744308|emb|CBI37278.3| unnamed protein product [Vitis vinifera] Length = 219 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -1 Query: 443 TENLRSQAQDFRQQGTKMRRKMWFQNMKMK 354 TENLRSQAQDFRQQGTKMRRKMW QNMK+K Sbjct: 166 TENLRSQAQDFRQQGTKMRRKMWLQNMKIK 195 >emb|CAN65946.1| hypothetical protein VITISV_029427 [Vitis vinifera] Length = 200 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -1 Query: 443 TENLRSQAQDFRQQGTKMRRKMWFQNMKMK 354 TENLRSQAQDFRQQGTKMRRKMW QNMK+K Sbjct: 147 TENLRSQAQDFRQQGTKMRRKMWMQNMKIK 176 >ref|XP_003622969.1| Vesicle-associated membrane protein [Medicago truncatula] gi|355497984|gb|AES79187.1| Vesicle-associated membrane protein [Medicago truncatula] Length = 221 Score = 61.2 bits (147), Expect = 1e-07 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -1 Query: 443 TENLRSQAQDFRQQGTKMRRKMWFQNMKMK 354 TENLRSQAQDFRQ GTK+RRKMWFQNMK+K Sbjct: 166 TENLRSQAQDFRQHGTKLRRKMWFQNMKIK 195 >gb|EPS70718.1| hypothetical protein M569_04041 [Genlisea aurea] Length = 220 Score = 60.8 bits (146), Expect = 2e-07 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -1 Query: 443 TENLRSQAQDFRQQGTKMRRKMWFQNMKMK 354 TENLRSQAQDFR QGTK+RRKMWFQNMK+K Sbjct: 166 TENLRSQAQDFRMQGTKIRRKMWFQNMKIK 195