BLASTX nr result
ID: Paeonia23_contig00008274
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00008274 (319 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS61110.1| hypothetical protein M569_13690 [Genlisea aurea] 80 3e-13 ref|XP_004241274.1| PREDICTED: 60S ribosomal protein L12-like [S... 80 3e-13 ref|NP_001275600.1| 60S ribosomal protein L12-like [Solanum tube... 80 3e-13 emb|CBI32732.3| unnamed protein product [Vitis vinifera] 80 3e-13 emb|CBI31460.3| unnamed protein product [Vitis vinifera] 80 3e-13 ref|XP_002281255.1| PREDICTED: 60S ribosomal protein L12 [Vitis ... 80 3e-13 ref|XP_002274407.1| PREDICTED: 60S ribosomal protein L12 [Vitis ... 80 3e-13 gb|EYU42156.1| hypothetical protein MIMGU_mgv1a024330mg [Mimulus... 80 4e-13 gb|EXB74645.1| 60S ribosomal protein L12 [Morus notabilis] gi|58... 80 4e-13 ref|XP_004505994.1| PREDICTED: 60S ribosomal protein L12-3-like ... 79 5e-13 gb|EYU36188.1| hypothetical protein MIMGU_mgv1a015152mg [Mimulus... 79 6e-13 ref|XP_004137822.1| PREDICTED: 60S ribosomal protein L12-1-like ... 79 6e-13 ref|XP_003606385.1| 60S ribosomal protein L12 [Medicago truncatu... 79 6e-13 ref|XP_007206032.1| hypothetical protein PRUPE_ppa012511mg [Prun... 79 8e-13 ref|XP_004143249.1| PREDICTED: 60S ribosomal protein L12-1-like ... 79 8e-13 gb|AAR83868.1| 60S ribosomal protein L12 [Capsicum annuum] 79 8e-13 ref|XP_006340196.1| PREDICTED: 60S ribosomal protein L12-like [S... 77 2e-12 ref|XP_006846773.1| hypothetical protein AMTR_s00148p00026900 [A... 77 2e-12 ref|XP_004291576.1| PREDICTED: 60S ribosomal protein L12-like [F... 77 2e-12 ref|XP_004250933.1| PREDICTED: 60S ribosomal protein L12-like [S... 77 2e-12 >gb|EPS61110.1| hypothetical protein M569_13690 [Genlisea aurea] Length = 166 Score = 80.1 bits (196), Expect = 3e-13 Identities = 36/40 (90%), Positives = 40/40 (100%) Frame = +3 Query: 3 TGTVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVDIPQD 122 TGTVKEILGTCVSVGCTVDGKDPK+LQQ+IADG+V+IPQD Sbjct: 127 TGTVKEILGTCVSVGCTVDGKDPKNLQQDIADGDVEIPQD 166 >ref|XP_004241274.1| PREDICTED: 60S ribosomal protein L12-like [Solanum lycopersicum] Length = 166 Score = 80.1 bits (196), Expect = 3e-13 Identities = 36/40 (90%), Positives = 39/40 (97%) Frame = +3 Query: 3 TGTVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVDIPQD 122 +GTVKEILGTCVSVGCTVDGKDPKDLQQEI DG+V+IPQD Sbjct: 127 SGTVKEILGTCVSVGCTVDGKDPKDLQQEITDGDVEIPQD 166 >ref|NP_001275600.1| 60S ribosomal protein L12-like [Solanum tuberosum] gi|418730035|gb|AFX66983.1| 60S ribosomal protein L12 [Solanum tuberosum] Length = 166 Score = 80.1 bits (196), Expect = 3e-13 Identities = 36/40 (90%), Positives = 39/40 (97%) Frame = +3 Query: 3 TGTVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVDIPQD 122 +GTVKEILGTCVSVGCTVDGKDPKDLQQEI DG+V+IPQD Sbjct: 127 SGTVKEILGTCVSVGCTVDGKDPKDLQQEITDGDVEIPQD 166 >emb|CBI32732.3| unnamed protein product [Vitis vinifera] Length = 110 Score = 80.1 bits (196), Expect = 3e-13 Identities = 36/40 (90%), Positives = 40/40 (100%) Frame = +3 Query: 3 TGTVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVDIPQD 122 +G+VKEILGTCVSVGCTVDGKDPKDLQQEIADG+V+IPQD Sbjct: 71 SGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGDVEIPQD 110 >emb|CBI31460.3| unnamed protein product [Vitis vinifera] Length = 163 Score = 80.1 bits (196), Expect = 3e-13 Identities = 35/40 (87%), Positives = 40/40 (100%) Frame = +3 Query: 3 TGTVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVDIPQD 122 +GTVKEILGTCVSVGCTVDGKDPKDLQQEIADG+V++P+D Sbjct: 124 SGTVKEILGTCVSVGCTVDGKDPKDLQQEIADGDVEVPED 163 >ref|XP_002281255.1| PREDICTED: 60S ribosomal protein L12 [Vitis vinifera] gi|147835636|emb|CAN66258.1| hypothetical protein VITISV_001237 [Vitis vinifera] Length = 166 Score = 80.1 bits (196), Expect = 3e-13 Identities = 36/40 (90%), Positives = 40/40 (100%) Frame = +3 Query: 3 TGTVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVDIPQD 122 +G+VKEILGTCVSVGCTVDGKDPKDLQQEIADG+V+IPQD Sbjct: 127 SGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGDVEIPQD 166 >ref|XP_002274407.1| PREDICTED: 60S ribosomal protein L12 [Vitis vinifera] gi|147785001|emb|CAN75443.1| hypothetical protein VITISV_019658 [Vitis vinifera] Length = 166 Score = 80.1 bits (196), Expect = 3e-13 Identities = 35/40 (87%), Positives = 40/40 (100%) Frame = +3 Query: 3 TGTVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVDIPQD 122 +GTVKEILGTCVSVGCTVDGKDPKDLQQEIADG+V++P+D Sbjct: 127 SGTVKEILGTCVSVGCTVDGKDPKDLQQEIADGDVEVPED 166 >gb|EYU42156.1| hypothetical protein MIMGU_mgv1a024330mg [Mimulus guttatus] Length = 166 Score = 79.7 bits (195), Expect = 4e-13 Identities = 35/39 (89%), Positives = 39/39 (100%) Frame = +3 Query: 6 GTVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVDIPQD 122 GTVKEILGTCVSVGCTVDGKDPKDLQQEI+DG+V++PQD Sbjct: 128 GTVKEILGTCVSVGCTVDGKDPKDLQQEISDGDVEVPQD 166 >gb|EXB74645.1| 60S ribosomal protein L12 [Morus notabilis] gi|587929045|gb|EXC16220.1| 60S ribosomal protein L12 [Morus notabilis] Length = 166 Score = 79.7 bits (195), Expect = 4e-13 Identities = 35/40 (87%), Positives = 39/40 (97%) Frame = +3 Query: 3 TGTVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVDIPQD 122 +GTVKEILGTCVSVGCTVDGKDPKDLQQE+ DG+V+IPQD Sbjct: 127 SGTVKEILGTCVSVGCTVDGKDPKDLQQEVTDGDVEIPQD 166 >ref|XP_004505994.1| PREDICTED: 60S ribosomal protein L12-3-like [Cicer arietinum] Length = 166 Score = 79.3 bits (194), Expect = 5e-13 Identities = 36/40 (90%), Positives = 39/40 (97%) Frame = +3 Query: 3 TGTVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVDIPQD 122 +GTVKEILGTCVSVGCTVDGKDPKDLQQEI DG+V+IPQD Sbjct: 127 SGTVKEILGTCVSVGCTVDGKDPKDLQQEINDGDVEIPQD 166 >gb|EYU36188.1| hypothetical protein MIMGU_mgv1a015152mg [Mimulus guttatus] Length = 166 Score = 79.0 bits (193), Expect = 6e-13 Identities = 35/39 (89%), Positives = 38/39 (97%) Frame = +3 Query: 6 GTVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVDIPQD 122 GTVKEILGTCVSVGCTVDGKDPKDLQQEIADG+V++P D Sbjct: 128 GTVKEILGTCVSVGCTVDGKDPKDLQQEIADGDVEVPMD 166 >ref|XP_004137822.1| PREDICTED: 60S ribosomal protein L12-1-like [Cucumis sativus] gi|449513637|ref|XP_004164383.1| PREDICTED: 60S ribosomal protein L12-1-like [Cucumis sativus] Length = 166 Score = 79.0 bits (193), Expect = 6e-13 Identities = 35/40 (87%), Positives = 40/40 (100%) Frame = +3 Query: 3 TGTVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVDIPQD 122 +G+VKEILGTCVSVGCTVDGKDPKDLQQEI+DG+V+IPQD Sbjct: 127 SGSVKEILGTCVSVGCTVDGKDPKDLQQEISDGDVEIPQD 166 >ref|XP_003606385.1| 60S ribosomal protein L12 [Medicago truncatula] gi|217071520|gb|ACJ84120.1| unknown [Medicago truncatula] gi|217075190|gb|ACJ85955.1| unknown [Medicago truncatula] gi|355507440|gb|AES88582.1| 60S ribosomal protein L12 [Medicago truncatula] gi|388514003|gb|AFK45063.1| unknown [Medicago truncatula] Length = 166 Score = 79.0 bits (193), Expect = 6e-13 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = +3 Query: 6 GTVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVDIPQD 122 GTVKEILGTCVSVGCTVDGKDPKDLQQEI DG+V+IPQD Sbjct: 128 GTVKEILGTCVSVGCTVDGKDPKDLQQEINDGDVEIPQD 166 >ref|XP_007206032.1| hypothetical protein PRUPE_ppa012511mg [Prunus persica] gi|595830258|ref|XP_007206036.1| hypothetical protein PRUPE_ppa012524mg [Prunus persica] gi|462401674|gb|EMJ07231.1| hypothetical protein PRUPE_ppa012511mg [Prunus persica] gi|462401678|gb|EMJ07235.1| hypothetical protein PRUPE_ppa012524mg [Prunus persica] Length = 166 Score = 78.6 bits (192), Expect = 8e-13 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = +3 Query: 6 GTVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVDIPQD 122 GTVKEILGTCVSVGCTVDGKDPKDLQQEIADG+V+IP D Sbjct: 128 GTVKEILGTCVSVGCTVDGKDPKDLQQEIADGDVEIPLD 166 >ref|XP_004143249.1| PREDICTED: 60S ribosomal protein L12-1-like [Cucumis sativus] gi|449482476|ref|XP_004156294.1| PREDICTED: 60S ribosomal protein L12-1-like [Cucumis sativus] Length = 166 Score = 78.6 bits (192), Expect = 8e-13 Identities = 35/40 (87%), Positives = 39/40 (97%) Frame = +3 Query: 3 TGTVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVDIPQD 122 +G+VKEILGTCVSVGCTVDGKDPKDLQQEI DG+V+IPQD Sbjct: 127 SGSVKEILGTCVSVGCTVDGKDPKDLQQEITDGDVEIPQD 166 >gb|AAR83868.1| 60S ribosomal protein L12 [Capsicum annuum] Length = 166 Score = 78.6 bits (192), Expect = 8e-13 Identities = 35/40 (87%), Positives = 40/40 (100%) Frame = +3 Query: 3 TGTVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVDIPQD 122 +GTVKEILGTCVSVGCTVDGKDPKDLQQEIADG+V+IP++ Sbjct: 127 SGTVKEILGTCVSVGCTVDGKDPKDLQQEIADGDVEIPEN 166 >ref|XP_006340196.1| PREDICTED: 60S ribosomal protein L12-like [Solanum tuberosum] Length = 166 Score = 77.4 bits (189), Expect = 2e-12 Identities = 34/40 (85%), Positives = 40/40 (100%) Frame = +3 Query: 3 TGTVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVDIPQD 122 +GTVKEILGTCVSVGCTVDGKDPKDLQQEI+DG+V+IP++ Sbjct: 127 SGTVKEILGTCVSVGCTVDGKDPKDLQQEISDGDVEIPEN 166 >ref|XP_006846773.1| hypothetical protein AMTR_s00148p00026900 [Amborella trichopoda] gi|548849595|gb|ERN08354.1| hypothetical protein AMTR_s00148p00026900 [Amborella trichopoda] Length = 166 Score = 77.4 bits (189), Expect = 2e-12 Identities = 34/40 (85%), Positives = 39/40 (97%) Frame = +3 Query: 3 TGTVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVDIPQD 122 TGTVKEILGTCVSVGCTVDGKDPKDLQ+EI+DG+V++P D Sbjct: 127 TGTVKEILGTCVSVGCTVDGKDPKDLQKEISDGDVEVPLD 166 >ref|XP_004291576.1| PREDICTED: 60S ribosomal protein L12-like [Fragaria vesca subsp. vesca] Length = 166 Score = 77.4 bits (189), Expect = 2e-12 Identities = 34/40 (85%), Positives = 39/40 (97%) Frame = +3 Query: 3 TGTVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVDIPQD 122 +GTVKEILGTCVSVGCTVDGKDPKDLQQEI+DG+V++P D Sbjct: 127 SGTVKEILGTCVSVGCTVDGKDPKDLQQEISDGDVEVPLD 166 >ref|XP_004250933.1| PREDICTED: 60S ribosomal protein L12-like [Solanum lycopersicum] gi|460411473|ref|XP_004251135.1| PREDICTED: 60S ribosomal protein L12-like [Solanum lycopersicum] Length = 166 Score = 77.4 bits (189), Expect = 2e-12 Identities = 34/40 (85%), Positives = 40/40 (100%) Frame = +3 Query: 3 TGTVKEILGTCVSVGCTVDGKDPKDLQQEIADGEVDIPQD 122 +GTVKEILGTCVSVGCTVDGKDPKDLQQEI+DG+V+IP++ Sbjct: 127 SGTVKEILGTCVSVGCTVDGKDPKDLQQEISDGDVEIPEN 166