BLASTX nr result
ID: Paeonia23_contig00008175
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00008175 (671 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002522671.1| transcription factor, putative [Ricinus comm... 59 2e-06 ref|XP_002522677.1| NAC domain-containing protein, putative [Ric... 58 3e-06 >ref|XP_002522671.1| transcription factor, putative [Ricinus communis] gi|223538147|gb|EEF39758.1| transcription factor, putative [Ricinus communis] Length = 422 Score = 58.5 bits (140), Expect = 2e-06 Identities = 30/63 (47%), Positives = 37/63 (58%), Gaps = 1/63 (1%) Frame = +1 Query: 481 FSPGNGELVEYLRKKNLGIPLDCCPIKDADVYSIHPRELAGMYPNNGEKVWYFFC-RSRP 657 F P + ELV YL+ K G PL I D D+Y HP+EL G Y GE+ WYFF R+R Sbjct: 138 FMPNDEELVNYLKHKIEGFPLPLGLIHDVDIYKFHPQELTGEYELIGEREWYFFTPRNRI 197 Query: 658 TDN 666 + N Sbjct: 198 SPN 200 >ref|XP_002522677.1| NAC domain-containing protein, putative [Ricinus communis] gi|223538153|gb|EEF39764.1| NAC domain-containing protein, putative [Ricinus communis] Length = 309 Score = 57.8 bits (138), Expect = 3e-06 Identities = 26/54 (48%), Positives = 31/54 (57%) Frame = +1 Query: 481 FSPGNGELVEYLRKKNLGIPLDCCPIKDADVYSIHPRELAGMYPNNGEKVWYFF 642 F P + ELV YL+ K G PL + D D+Y HP EL G Y GE+ WYFF Sbjct: 25 FMPNDEELVNYLKHKVEGFPLPLGLVHDVDIYKFHPHELTGKYELIGEREWYFF 78