BLASTX nr result
ID: Paeonia23_contig00007619
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00007619 (396 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007147536.1| hypothetical protein PHAVU_006G132900g [Phas... 171 1e-40 ref|XP_007218569.1| hypothetical protein PRUPE_ppa013025mg [Prun... 170 2e-40 ref|NP_001235232.1| uncharacterized protein LOC100527890 [Glycin... 170 2e-40 ref|XP_007215111.1| hypothetical protein PRUPE_ppa012881mg [Prun... 168 6e-40 ref|XP_007009031.1| Pleckstrin (PH) domain superfamily protein [... 167 1e-39 ref|XP_004307627.1| PREDICTED: pleckstrin homology domain-contai... 167 2e-39 ref|XP_003519389.1| PREDICTED: pleckstrin homology domain-contai... 167 2e-39 ref|XP_002269271.1| PREDICTED: pleckstrin homology domain-contai... 163 3e-38 ref|XP_004490979.1| PREDICTED: pleckstrin homology domain-contai... 162 6e-38 ref|XP_003616621.1| Pleckstrin homology domain-containing protei... 160 2e-37 ref|XP_002871177.1| hypothetical protein ARALYDRAFT_487373 [Arab... 160 2e-37 gb|AAM61053.1| AtPH1-like protein [Arabidopsis thaliana] 160 2e-37 ref|XP_006355665.1| PREDICTED: pleckstrin homology domain-contai... 159 3e-37 ref|NP_196190.1| pleckstrin homology domain-containing protein [... 158 8e-37 gb|EXB58195.1| Pleckstrin-like domain-containing protein 1 [Moru... 157 1e-36 ref|XP_002279631.1| PREDICTED: pleckstrin homology domain-contai... 157 1e-36 ref|XP_004239931.1| PREDICTED: pleckstrin homology domain-contai... 157 1e-36 ref|XP_002312150.2| pleckstrin homology domain-containing family... 156 2e-36 ref|XP_006435708.1| hypothetical protein CICLE_v10033015mg [Citr... 156 3e-36 ref|XP_002315163.2| pleckstrin homology domain-containing family... 154 9e-36 >ref|XP_007147536.1| hypothetical protein PHAVU_006G132900g [Phaseolus vulgaris] gi|593694032|ref|XP_007147537.1| hypothetical protein PHAVU_006G132900g [Phaseolus vulgaris] gi|543176612|gb|AGV54329.1| pleckstrin homology domain-containing protein [Phaseolus vulgaris] gi|561020759|gb|ESW19530.1| hypothetical protein PHAVU_006G132900g [Phaseolus vulgaris] gi|561020760|gb|ESW19531.1| hypothetical protein PHAVU_006G132900g [Phaseolus vulgaris] Length = 146 Score = 171 bits (433), Expect = 1e-40 Identities = 78/92 (84%), Positives = 84/92 (91%) Frame = +3 Query: 117 MVSLWRAATGYSDKPHNTDYDGIEFWSNPERTGWLTKQGEYIKTWRRRWFVLKQGKLFWF 296 M SLWRAATG S+ P TDYDG+EFWSNPERTGWLTKQGEYIKTWRRRWFVLKQGKLFWF Sbjct: 1 MASLWRAATGMSENP--TDYDGVEFWSNPERTGWLTKQGEYIKTWRRRWFVLKQGKLFWF 58 Query: 297 KDSFVTRVSVPRGVIPVATCLTVKGADDVLNK 392 K+S VTR S PRGV+PVATCLTVKGA+D+LNK Sbjct: 59 KESAVTRASRPRGVVPVATCLTVKGAEDILNK 90 >ref|XP_007218569.1| hypothetical protein PRUPE_ppa013025mg [Prunus persica] gi|462415031|gb|EMJ19768.1| hypothetical protein PRUPE_ppa013025mg [Prunus persica] Length = 143 Score = 170 bits (430), Expect = 2e-40 Identities = 79/93 (84%), Positives = 85/93 (91%) Frame = +3 Query: 117 MVSLWRAATGYSDKPHNTDYDGIEFWSNPERTGWLTKQGEYIKTWRRRWFVLKQGKLFWF 296 M SLWRAATG ++KP+ DYDG+EFW NPERTGWLTKQGEYIKTWRRRWFVLKQGKLFWF Sbjct: 1 MASLWRAATGQTEKPN--DYDGVEFWLNPERTGWLTKQGEYIKTWRRRWFVLKQGKLFWF 58 Query: 297 KDSFVTRVSVPRGVIPVATCLTVKGADDVLNKQ 395 KDS VTR S PRGVIPVA+CLTVKGA+DVLNKQ Sbjct: 59 KDSTVTRGSSPRGVIPVASCLTVKGAEDVLNKQ 91 >ref|NP_001235232.1| uncharacterized protein LOC100527890 [Glycine max] gi|571505514|ref|XP_006595539.1| PREDICTED: uncharacterized protein LOC100527890 isoform X1 [Glycine max] gi|571505517|ref|XP_006595540.1| PREDICTED: uncharacterized protein LOC100527890 isoform X2 [Glycine max] gi|255633474|gb|ACU17095.1| unknown [Glycine max] Length = 146 Score = 170 bits (430), Expect = 2e-40 Identities = 78/92 (84%), Positives = 83/92 (90%) Frame = +3 Query: 117 MVSLWRAATGYSDKPHNTDYDGIEFWSNPERTGWLTKQGEYIKTWRRRWFVLKQGKLFWF 296 M SLWRAATG +D TDYDG+EFWSNPERTGWLTKQGEYIKTWRRRWFVLKQGKLFWF Sbjct: 1 MASLWRAATGMTDNA--TDYDGVEFWSNPERTGWLTKQGEYIKTWRRRWFVLKQGKLFWF 58 Query: 297 KDSFVTRVSVPRGVIPVATCLTVKGADDVLNK 392 KDS VTR S PRGV+PVATCLTVKGA+D+LNK Sbjct: 59 KDSAVTRASRPRGVVPVATCLTVKGAEDILNK 90 >ref|XP_007215111.1| hypothetical protein PRUPE_ppa012881mg [Prunus persica] gi|462411261|gb|EMJ16310.1| hypothetical protein PRUPE_ppa012881mg [Prunus persica] Length = 151 Score = 168 bits (426), Expect = 6e-40 Identities = 78/93 (83%), Positives = 85/93 (91%) Frame = +3 Query: 117 MVSLWRAATGYSDKPHNTDYDGIEFWSNPERTGWLTKQGEYIKTWRRRWFVLKQGKLFWF 296 M SLWRAATG ++KP+ DYDG+EFW NPERTGWLTK+GEYIKTWRRRWFVLKQGKLFWF Sbjct: 1 MASLWRAATGQTEKPN--DYDGVEFWLNPERTGWLTKRGEYIKTWRRRWFVLKQGKLFWF 58 Query: 297 KDSFVTRVSVPRGVIPVATCLTVKGADDVLNKQ 395 KDS VTR S PRGVIPVA+CLTVKGA+DVLNKQ Sbjct: 59 KDSTVTRGSSPRGVIPVASCLTVKGAEDVLNKQ 91 >ref|XP_007009031.1| Pleckstrin (PH) domain superfamily protein [Theobroma cacao] gi|508725944|gb|EOY17841.1| Pleckstrin (PH) domain superfamily protein [Theobroma cacao] Length = 143 Score = 167 bits (423), Expect = 1e-39 Identities = 76/93 (81%), Positives = 85/93 (91%) Frame = +3 Query: 117 MVSLWRAATGYSDKPHNTDYDGIEFWSNPERTGWLTKQGEYIKTWRRRWFVLKQGKLFWF 296 M SLWRAAT ++KP+ DYDG+EFWSNPERTGWLTKQGEYIKTWRRRWFVLKQGKLFWF Sbjct: 1 MASLWRAATALTEKPN--DYDGVEFWSNPERTGWLTKQGEYIKTWRRRWFVLKQGKLFWF 58 Query: 297 KDSFVTRVSVPRGVIPVATCLTVKGADDVLNKQ 395 K+S +TR S PRGVIPVA+CLTVKGA+D+LNKQ Sbjct: 59 KESTITRGSRPRGVIPVASCLTVKGAEDILNKQ 91 >ref|XP_004307627.1| PREDICTED: pleckstrin homology domain-containing protein 1-like [Fragaria vesca subsp. vesca] Length = 144 Score = 167 bits (422), Expect = 2e-39 Identities = 79/93 (84%), Positives = 83/93 (89%) Frame = +3 Query: 117 MVSLWRAATGYSDKPHNTDYDGIEFWSNPERTGWLTKQGEYIKTWRRRWFVLKQGKLFWF 296 M SLWRAATG + KP D+DG+EFWSNPERTGWLTKQGEYIKTWRRRWFVLKQGKLFWF Sbjct: 1 MASLWRAATGLTFKPD--DHDGVEFWSNPERTGWLTKQGEYIKTWRRRWFVLKQGKLFWF 58 Query: 297 KDSFVTRVSVPRGVIPVATCLTVKGADDVLNKQ 395 KDS VTR S RGVIPVATCLTVKGA+DVLNKQ Sbjct: 59 KDSSVTRASRSRGVIPVATCLTVKGAEDVLNKQ 91 >ref|XP_003519389.1| PREDICTED: pleckstrin homology domain-containing protein 1-like [Glycine max] Length = 148 Score = 167 bits (422), Expect = 2e-39 Identities = 76/92 (82%), Positives = 83/92 (90%) Frame = +3 Query: 117 MVSLWRAATGYSDKPHNTDYDGIEFWSNPERTGWLTKQGEYIKTWRRRWFVLKQGKLFWF 296 M SLWRAATG ++ TDYDG+EFWSNPERTGWLTKQGEYIKTWRRRWFVLKQGKLFWF Sbjct: 1 MASLWRAATGMTENA--TDYDGVEFWSNPERTGWLTKQGEYIKTWRRRWFVLKQGKLFWF 58 Query: 297 KDSFVTRVSVPRGVIPVATCLTVKGADDVLNK 392 K+S VTR S PRGV+PVATCLTVKGA+D+LNK Sbjct: 59 KESSVTRASRPRGVVPVATCLTVKGAEDILNK 90 >ref|XP_002269271.1| PREDICTED: pleckstrin homology domain-containing protein 1 [Vitis vinifera] Length = 143 Score = 163 bits (412), Expect = 3e-38 Identities = 76/93 (81%), Positives = 83/93 (89%) Frame = +3 Query: 117 MVSLWRAATGYSDKPHNTDYDGIEFWSNPERTGWLTKQGEYIKTWRRRWFVLKQGKLFWF 296 M SLWRAATG +D + DY G+EFWSNPERTGWLTKQGEYIKTWRRRWFVLKQGKLFWF Sbjct: 1 MWSLWRAATGTADD--SDDYGGVEFWSNPERTGWLTKQGEYIKTWRRRWFVLKQGKLFWF 58 Query: 297 KDSFVTRVSVPRGVIPVATCLTVKGADDVLNKQ 395 K+S +TR S PRGVIPVA+CLTVKGA+DVLNKQ Sbjct: 59 KESTITRASRPRGVIPVASCLTVKGAEDVLNKQ 91 >ref|XP_004490979.1| PREDICTED: pleckstrin homology domain-containing protein 1-like [Cicer arietinum] Length = 144 Score = 162 bits (409), Expect = 6e-38 Identities = 74/92 (80%), Positives = 82/92 (89%) Frame = +3 Query: 117 MVSLWRAATGYSDKPHNTDYDGIEFWSNPERTGWLTKQGEYIKTWRRRWFVLKQGKLFWF 296 M SLWRAATG ++ + DYDG+EFWSNPERTGWL KQGEYIKTWRRRWFVLKQGKLFWF Sbjct: 1 MASLWRAATGLTE--NQNDYDGVEFWSNPERTGWLMKQGEYIKTWRRRWFVLKQGKLFWF 58 Query: 297 KDSFVTRVSVPRGVIPVATCLTVKGADDVLNK 392 K+S + RVS PRGVIPVATCLTVKGA+DVL+K Sbjct: 59 KESTINRVSKPRGVIPVATCLTVKGAEDVLHK 90 >ref|XP_003616621.1| Pleckstrin homology domain-containing protein [Medicago truncatula] gi|355517956|gb|AES99579.1| Pleckstrin homology domain-containing protein [Medicago truncatula] gi|388509562|gb|AFK42847.1| unknown [Medicago truncatula] Length = 144 Score = 160 bits (405), Expect = 2e-37 Identities = 72/90 (80%), Positives = 80/90 (88%) Frame = +3 Query: 123 SLWRAATGYSDKPHNTDYDGIEFWSNPERTGWLTKQGEYIKTWRRRWFVLKQGKLFWFKD 302 SLWR ATG + P DY G+EFWSNPERTGWLTKQGEYIKTWRRRWFVLKQGKLFWFK+ Sbjct: 4 SLWRYATGSTTNP--VDYSGVEFWSNPERTGWLTKQGEYIKTWRRRWFVLKQGKLFWFKE 61 Query: 303 SFVTRVSVPRGVIPVATCLTVKGADDVLNK 392 S +TR S+PRGVIPVATCLTVKGA+D+L+K Sbjct: 62 STITRASIPRGVIPVATCLTVKGAEDILHK 91 >ref|XP_002871177.1| hypothetical protein ARALYDRAFT_487373 [Arabidopsis lyrata subsp. lyrata] gi|297317014|gb|EFH47436.1| hypothetical protein ARALYDRAFT_487373 [Arabidopsis lyrata subsp. lyrata] Length = 144 Score = 160 bits (404), Expect = 2e-37 Identities = 74/93 (79%), Positives = 80/93 (86%) Frame = +3 Query: 117 MVSLWRAATGYSDKPHNTDYDGIEFWSNPERTGWLTKQGEYIKTWRRRWFVLKQGKLFWF 296 M SLWRA G ++ DY G+EFWSNPERTGWLTKQGEYIKTWRRRWFVLKQGKLFWF Sbjct: 1 MASLWRAVIG-GQSNNSDDYGGVEFWSNPERTGWLTKQGEYIKTWRRRWFVLKQGKLFWF 59 Query: 297 KDSFVTRVSVPRGVIPVATCLTVKGADDVLNKQ 395 KDS VTRVS PRGV+PVA+CLT KGA+DVLNKQ Sbjct: 60 KDSDVTRVSRPRGVVPVASCLTAKGAEDVLNKQ 92 >gb|AAM61053.1| AtPH1-like protein [Arabidopsis thaliana] Length = 144 Score = 160 bits (404), Expect = 2e-37 Identities = 74/93 (79%), Positives = 81/93 (87%) Frame = +3 Query: 117 MVSLWRAATGYSDKPHNTDYDGIEFWSNPERTGWLTKQGEYIKTWRRRWFVLKQGKLFWF 296 M SLWRA G + ++ DY G+EFWSNPERTGWLTKQGEYIKTWRRRWFVLKQGKLFWF Sbjct: 1 MASLWRAVIGGQNN-NSEDYGGVEFWSNPERTGWLTKQGEYIKTWRRRWFVLKQGKLFWF 59 Query: 297 KDSFVTRVSVPRGVIPVATCLTVKGADDVLNKQ 395 KDS VTRVS PRGV+PVA+CLT KGA+DVLNKQ Sbjct: 60 KDSDVTRVSRPRGVVPVASCLTAKGAEDVLNKQ 92 >ref|XP_006355665.1| PREDICTED: pleckstrin homology domain-containing protein 1-like [Solanum tuberosum] Length = 147 Score = 159 bits (403), Expect = 3e-37 Identities = 71/93 (76%), Positives = 78/93 (83%) Frame = +3 Query: 117 MVSLWRAATGYSDKPHNTDYDGIEFWSNPERTGWLTKQGEYIKTWRRRWFVLKQGKLFWF 296 M SLWRA G + P DYDG+EFW NPERTGWLTKQGEYIKTWRRRWFVLKQGKLFWF Sbjct: 1 MASLWRAVMGDNTTPSTDDYDGVEFWVNPERTGWLTKQGEYIKTWRRRWFVLKQGKLFWF 60 Query: 297 KDSFVTRVSVPRGVIPVATCLTVKGADDVLNKQ 395 K++ + R S PRGV+PVA CLTVKGA+DVLNKQ Sbjct: 61 KEANINRGSKPRGVVPVANCLTVKGAEDVLNKQ 93 >ref|NP_196190.1| pleckstrin homology domain-containing protein [Arabidopsis thaliana] gi|9759096|dbj|BAB09665.1| AtPH1-like protein [Arabidopsis thaliana] gi|98960875|gb|ABF58921.1| At5g05710 [Arabidopsis thaliana] gi|110737775|dbj|BAF00826.1| AtPH1-like protein [Arabidopsis thaliana] gi|332003530|gb|AED90913.1| pleckstrin homology domain-containing protein [Arabidopsis thaliana] Length = 144 Score = 158 bits (399), Expect = 8e-37 Identities = 73/93 (78%), Positives = 80/93 (86%) Frame = +3 Query: 117 MVSLWRAATGYSDKPHNTDYDGIEFWSNPERTGWLTKQGEYIKTWRRRWFVLKQGKLFWF 296 M SLWRA G + ++ DY G+EFWSNPERTGWLTKQGEYIKTWRRRWFVLKQGKLFWF Sbjct: 1 MASLWRAVIGGQNN-NSEDYGGVEFWSNPERTGWLTKQGEYIKTWRRRWFVLKQGKLFWF 59 Query: 297 KDSFVTRVSVPRGVIPVATCLTVKGADDVLNKQ 395 KDS VTRVS PRGV+PV +CLT KGA+DVLNKQ Sbjct: 60 KDSDVTRVSRPRGVVPVESCLTAKGAEDVLNKQ 92 >gb|EXB58195.1| Pleckstrin-like domain-containing protein 1 [Morus notabilis] Length = 143 Score = 157 bits (398), Expect = 1e-36 Identities = 75/93 (80%), Positives = 79/93 (84%) Frame = +3 Query: 117 MVSLWRAATGYSDKPHNTDYDGIEFWSNPERTGWLTKQGEYIKTWRRRWFVLKQGKLFWF 296 M SLWRAATG + DY G+EFWS PER GWLTKQGEYIKTWRRRWFVLKQGKLFWF Sbjct: 1 MASLWRAATG--QWASSDDYGGVEFWSTPERGGWLTKQGEYIKTWRRRWFVLKQGKLFWF 58 Query: 297 KDSFVTRVSVPRGVIPVATCLTVKGADDVLNKQ 395 KDS VTR S PRGVIPVA+CLTVKGA+DVLNKQ Sbjct: 59 KDSAVTRASRPRGVIPVASCLTVKGAEDVLNKQ 91 >ref|XP_002279631.1| PREDICTED: pleckstrin homology domain-containing protein 1 [Vitis vinifera] gi|147863745|emb|CAN83611.1| hypothetical protein VITISV_035612 [Vitis vinifera] Length = 143 Score = 157 bits (398), Expect = 1e-36 Identities = 72/93 (77%), Positives = 78/93 (83%) Frame = +3 Query: 117 MVSLWRAATGYSDKPHNTDYDGIEFWSNPERTGWLTKQGEYIKTWRRRWFVLKQGKLFWF 296 M LWRAA G KP DY+G++FWS PER GWLTKQGEYIKTWRRRWFVLK+GKLFWF Sbjct: 1 MEGLWRAAAGLDPKPE--DYEGVDFWSTPERAGWLTKQGEYIKTWRRRWFVLKRGKLFWF 58 Query: 297 KDSFVTRVSVPRGVIPVATCLTVKGADDVLNKQ 395 KDS+VT S PRGVIPV TCLTVKGA+DVLNKQ Sbjct: 59 KDSYVTHDSKPRGVIPVGTCLTVKGAEDVLNKQ 91 >ref|XP_004239931.1| PREDICTED: pleckstrin homology domain-containing protein 1-like [Solanum lycopersicum] Length = 147 Score = 157 bits (397), Expect = 1e-36 Identities = 71/93 (76%), Positives = 77/93 (82%) Frame = +3 Query: 117 MVSLWRAATGYSDKPHNTDYDGIEFWSNPERTGWLTKQGEYIKTWRRRWFVLKQGKLFWF 296 M SLWRA G + P DYDG+EFW NPER GWLTKQGEYIKTWRRRWFVLKQGKLFWF Sbjct: 1 MASLWRAVMGDNTTPSTDDYDGVEFWVNPERAGWLTKQGEYIKTWRRRWFVLKQGKLFWF 60 Query: 297 KDSFVTRVSVPRGVIPVATCLTVKGADDVLNKQ 395 K++ + R S PRGVIPVA CLTVKGA+DVLNKQ Sbjct: 61 KEANLNRGSKPRGVIPVANCLTVKGAEDVLNKQ 93 >ref|XP_002312150.2| pleckstrin homology domain-containing family protein [Populus trichocarpa] gi|550332562|gb|EEE89517.2| pleckstrin homology domain-containing family protein [Populus trichocarpa] Length = 150 Score = 156 bits (395), Expect = 2e-36 Identities = 72/97 (74%), Positives = 83/97 (85%) Frame = +3 Query: 105 MASQMVSLWRAATGYSDKPHNTDYDGIEFWSNPERTGWLTKQGEYIKTWRRRWFVLKQGK 284 ++ M SLWRAAT + + +T DG+EFWSNPERTGWL KQGE+IKTWRRRWF+LKQGK Sbjct: 3 LSDSMASLWRAATALT-QTQSTQTDGVEFWSNPERTGWLMKQGEHIKTWRRRWFILKQGK 61 Query: 285 LFWFKDSFVTRVSVPRGVIPVATCLTVKGADDVLNKQ 395 LFWFKDS VTRV PRGVIPVA+CLTVKGA+DVL+KQ Sbjct: 62 LFWFKDSTVTRVCKPRGVIPVASCLTVKGAEDVLHKQ 98 >ref|XP_006435708.1| hypothetical protein CICLE_v10033015mg [Citrus clementina] gi|568865967|ref|XP_006486336.1| PREDICTED: pleckstrin homology domain-containing protein 1-like [Citrus sinensis] gi|557537904|gb|ESR48948.1| hypothetical protein CICLE_v10033015mg [Citrus clementina] Length = 143 Score = 156 bits (394), Expect = 3e-36 Identities = 73/93 (78%), Positives = 82/93 (88%) Frame = +3 Query: 117 MVSLWRAATGYSDKPHNTDYDGIEFWSNPERTGWLTKQGEYIKTWRRRWFVLKQGKLFWF 296 M SLWRA +G +++ +DYD EFWSNPER+GWLTKQGEYIKTWRRRWFVLKQGKLFWF Sbjct: 1 MGSLWRAISGQTNQL--SDYDSTEFWSNPERSGWLTKQGEYIKTWRRRWFVLKQGKLFWF 58 Query: 297 KDSFVTRVSVPRGVIPVATCLTVKGADDVLNKQ 395 K+S VTR S PRGVIPVA+CLTVKGA+DVLNKQ Sbjct: 59 KESTVTRASKPRGVIPVASCLTVKGAEDVLNKQ 91 >ref|XP_002315163.2| pleckstrin homology domain-containing family protein [Populus trichocarpa] gi|550330185|gb|EEF01334.2| pleckstrin homology domain-containing family protein [Populus trichocarpa] Length = 148 Score = 154 bits (390), Expect = 9e-36 Identities = 72/93 (77%), Positives = 82/93 (88%) Frame = +3 Query: 117 MVSLWRAATGYSDKPHNTDYDGIEFWSNPERTGWLTKQGEYIKTWRRRWFVLKQGKLFWF 296 MVSLWRAAT + + +T DG+EFWS+PERTGWL KQGE+IKTWRRRWFVLKQGKLFWF Sbjct: 1 MVSLWRAATALT-QTQSTQTDGVEFWSSPERTGWLMKQGEHIKTWRRRWFVLKQGKLFWF 59 Query: 297 KDSFVTRVSVPRGVIPVATCLTVKGADDVLNKQ 395 KDS VTRVS PRG IPVA+CLTVKGA+DVL++Q Sbjct: 60 KDSTVTRVSKPRGAIPVASCLTVKGAEDVLHRQ 92