BLASTX nr result
ID: Paeonia23_contig00007450
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00007450 (611 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAF80556.1|AF188843_1 plasma membrane aquaporin [Vitis vinifera] 48 4e-07 gb|AAF71818.1|AF141898_1 putative aquaporin PIP1-2 [Vitis cinere... 48 4e-07 ref|XP_007160075.1| hypothetical protein PHAVU_002G290400g [Phas... 47 1e-06 gb|AAY22204.1| putative aquaporin [Phaseolus vulgaris] 47 1e-06 ref|XP_002315171.1| hypothetical protein POPTR_0010s19930g [Popu... 46 1e-06 ref|XP_004503705.1| PREDICTED: probable aquaporin PIP1-2-like [C... 46 1e-06 gb|AFO63680.1| plasma intrinsic protein 1 [Eriobotrya japonica] 46 1e-06 ref|NP_001267949.1| aquaporin PIP1;2 [Vitis vinifera] gi|1247025... 46 1e-06 gb|ABN14348.1| aquaporin PIP1;2 [Vitis vinifera] 46 1e-06 emb|CBI40388.3| unnamed protein product [Vitis vinifera] 46 1e-06 ref|XP_003532817.1| PREDICTED: probable aquaporin PIP1-2 [Glycin... 46 2e-06 gb|ACU24274.1| unknown [Glycine max] 46 2e-06 dbj|BAI94500.1| plasma membrane intrinsic protein [Dianthus cary... 45 2e-06 gb|AGW15994.1| plasma membrane intrinsic protein 1 [Malus domest... 46 2e-06 gb|AAF80557.1|AF188844_1 plasma membrane aquaporin [Vitis vinifera] 45 2e-06 ref|NP_001242504.1| uncharacterized protein LOC100793242 [Glycin... 45 2e-06 ref|NP_001267921.1| aquaporin-like [Vitis vinifera] gi|124702509... 45 2e-06 gb|ABH09324.1| putative aquaporin [Vitis vinifera] 45 2e-06 gb|AAF71819.1|AF141899_1 putative aquaporin PIP1-3 [Vitis cinere... 45 2e-06 gb|ACR56610.1| plasma intrinsic protein 1;1 [Juglans regia] 45 2e-06 >gb|AAF80556.1|AF188843_1 plasma membrane aquaporin [Vitis vinifera] Length = 286 Score = 47.8 bits (112), Expect(2) = 4e-07 Identities = 22/43 (51%), Positives = 29/43 (67%) Frame = +1 Query: 289 SAIYSLYLCLGAIYGASMVKTFKGKQFELLSSGANFVNLSYTK 417 + Y + CLGAI GAS+VK F+G Q+E+L GAN V Y+K Sbjct: 132 AVFYMIMQCLGAICGASVVKGFQGHQYEVLGGGANVVAAGYSK 174 Score = 32.3 bits (72), Expect(2) = 4e-07 Identities = 11/17 (64%), Positives = 17/17 (100%) Frame = +3 Query: 414 QGDGLGAKVIGTFVVIY 464 +GDGLGA+++GTFV++Y Sbjct: 174 KGDGLGAEIVGTFVLVY 190 >gb|AAF71818.1|AF141898_1 putative aquaporin PIP1-2 [Vitis cinerea var. helleri x Vitis rupestris] Length = 286 Score = 47.8 bits (112), Expect(2) = 4e-07 Identities = 22/43 (51%), Positives = 28/43 (65%) Frame = +1 Query: 289 SAIYSLYLCLGAIYGASMVKTFKGKQFELLSSGANFVNLSYTK 417 + Y + CLGAI GA +VK F+G Q+E+L GAN V YTK Sbjct: 132 AVFYMIMQCLGAICGAGVVKGFQGHQYEVLGGGANVVAAGYTK 174 Score = 32.3 bits (72), Expect(2) = 4e-07 Identities = 11/17 (64%), Positives = 17/17 (100%) Frame = +3 Query: 414 QGDGLGAKVIGTFVVIY 464 +GDGLGA+++GTFV++Y Sbjct: 174 KGDGLGAEIVGTFVLVY 190 >ref|XP_007160075.1| hypothetical protein PHAVU_002G290400g [Phaseolus vulgaris] gi|561033490|gb|ESW32069.1| hypothetical protein PHAVU_002G290400g [Phaseolus vulgaris] Length = 287 Score = 46.6 bits (109), Expect(2) = 1e-06 Identities = 23/44 (52%), Positives = 29/44 (65%), Gaps = 1/44 (2%) Frame = +1 Query: 289 SAIYSLYLCLGAIYGASMVKTFKGK-QFELLSSGANFVNLSYTK 417 + Y + CLGAI GA +VK F+G ++EL GANFVN YTK Sbjct: 132 AVFYIIMQCLGAICGAGVVKGFEGNGRYELFKGGANFVNSGYTK 175 Score = 32.3 bits (72), Expect(2) = 1e-06 Identities = 11/17 (64%), Positives = 17/17 (100%) Frame = +3 Query: 414 QGDGLGAKVIGTFVVIY 464 +GDGLGA+++GTFV++Y Sbjct: 175 KGDGLGAEIVGTFVLVY 191 >gb|AAY22204.1| putative aquaporin [Phaseolus vulgaris] Length = 287 Score = 46.6 bits (109), Expect(2) = 1e-06 Identities = 23/44 (52%), Positives = 29/44 (65%), Gaps = 1/44 (2%) Frame = +1 Query: 289 SAIYSLYLCLGAIYGASMVKTFKGK-QFELLSSGANFVNLSYTK 417 + Y + CLGAI GA +VK F+G ++EL GANFVN YTK Sbjct: 132 AVFYIIMQCLGAICGAGVVKGFEGNGRYELFKGGANFVNSGYTK 175 Score = 32.3 bits (72), Expect(2) = 1e-06 Identities = 11/17 (64%), Positives = 17/17 (100%) Frame = +3 Query: 414 QGDGLGAKVIGTFVVIY 464 +GDGLGA+++GTFV++Y Sbjct: 175 KGDGLGAEIVGTFVLVY 191 >ref|XP_002315171.1| hypothetical protein POPTR_0010s19930g [Populus trichocarpa] gi|118486523|gb|ABK95101.1| unknown [Populus trichocarpa] gi|222864211|gb|EEF01342.1| hypothetical protein POPTR_0010s19930g [Populus trichocarpa] Length = 287 Score = 45.8 bits (107), Expect(2) = 1e-06 Identities = 24/44 (54%), Positives = 30/44 (68%), Gaps = 1/44 (2%) Frame = +1 Query: 289 SAIYSLYLCLGAIYGASMVKTFKGKQ-FELLSSGANFVNLSYTK 417 + Y L CLGAI GA +VK F GK+ +ELL+ GAN V+ YTK Sbjct: 134 AVFYMLMQCLGAICGAGVVKGFYGKKNYELLNGGANMVSPGYTK 177 Score = 33.1 bits (74), Expect(2) = 1e-06 Identities = 12/21 (57%), Positives = 18/21 (85%) Frame = +3 Query: 402 PELHQGDGLGAKVIGTFVVIY 464 P +GDGLGA+++GTFV++Y Sbjct: 173 PGYTKGDGLGAEIVGTFVLVY 193 >ref|XP_004503705.1| PREDICTED: probable aquaporin PIP1-2-like [Cicer arietinum] Length = 286 Score = 46.2 bits (108), Expect(2) = 1e-06 Identities = 23/41 (56%), Positives = 28/41 (68%), Gaps = 1/41 (2%) Frame = +1 Query: 298 YSLYLCLGAIYGASMVKTFKGK-QFELLSSGANFVNLSYTK 417 Y + CLGAI GA +VK F+G ++EL GANFVN YTK Sbjct: 134 YIVMQCLGAICGAGVVKGFEGNARYELFKGGANFVNAGYTK 174 Score = 32.3 bits (72), Expect(2) = 1e-06 Identities = 11/17 (64%), Positives = 17/17 (100%) Frame = +3 Query: 414 QGDGLGAKVIGTFVVIY 464 +GDGLGA+++GTFV++Y Sbjct: 174 KGDGLGAEIVGTFVLVY 190 >gb|AFO63680.1| plasma intrinsic protein 1 [Eriobotrya japonica] Length = 286 Score = 46.2 bits (108), Expect(2) = 1e-06 Identities = 23/43 (53%), Positives = 28/43 (65%) Frame = +1 Query: 289 SAIYSLYLCLGAIYGASMVKTFKGKQFELLSSGANFVNLSYTK 417 S Y + LGA+ GA +VK F+ KQ+ELL GAN VN YTK Sbjct: 132 SVFYIIMQSLGAMAGAGVVKGFQTKQYELLGGGANVVNHGYTK 174 Score = 32.3 bits (72), Expect(2) = 1e-06 Identities = 11/17 (64%), Positives = 17/17 (100%) Frame = +3 Query: 414 QGDGLGAKVIGTFVVIY 464 +GDGLGA+++GTFV++Y Sbjct: 174 KGDGLGAEIVGTFVLVY 190 >ref|NP_001267949.1| aquaporin PIP1;2 [Vitis vinifera] gi|124702523|gb|ABN14350.1| aquaporin PIP1;4 [Vitis vinifera] Length = 286 Score = 46.2 bits (108), Expect(2) = 1e-06 Identities = 21/43 (48%), Positives = 28/43 (65%) Frame = +1 Query: 289 SAIYSLYLCLGAIYGASMVKTFKGKQFELLSSGANFVNLSYTK 417 + Y + CLGAI GA +VK F+G Q+E+L GAN V Y+K Sbjct: 132 AVFYMIMQCLGAICGAGVVKGFQGHQYEVLGGGANVVAAGYSK 174 Score = 32.3 bits (72), Expect(2) = 1e-06 Identities = 11/17 (64%), Positives = 17/17 (100%) Frame = +3 Query: 414 QGDGLGAKVIGTFVVIY 464 +GDGLGA+++GTFV++Y Sbjct: 174 KGDGLGAEIVGTFVLVY 190 >gb|ABN14348.1| aquaporin PIP1;2 [Vitis vinifera] Length = 286 Score = 46.2 bits (108), Expect(2) = 1e-06 Identities = 21/43 (48%), Positives = 28/43 (65%) Frame = +1 Query: 289 SAIYSLYLCLGAIYGASMVKTFKGKQFELLSSGANFVNLSYTK 417 + Y + CLGAI GA +VK F+G Q+E+L GAN V Y+K Sbjct: 132 AVFYMIMQCLGAICGAGVVKGFQGHQYEVLGGGANVVAAGYSK 174 Score = 32.3 bits (72), Expect(2) = 1e-06 Identities = 11/17 (64%), Positives = 17/17 (100%) Frame = +3 Query: 414 QGDGLGAKVIGTFVVIY 464 +GDGLGA+++GTFV++Y Sbjct: 174 KGDGLGAEIVGTFVLVY 190 >emb|CBI40388.3| unnamed protein product [Vitis vinifera] Length = 190 Score = 46.2 bits (108), Expect(2) = 1e-06 Identities = 21/43 (48%), Positives = 28/43 (65%) Frame = +1 Query: 289 SAIYSLYLCLGAIYGASMVKTFKGKQFELLSSGANFVNLSYTK 417 + Y + CLGAI GA +VK F+G Q+E+L GAN V Y+K Sbjct: 36 AVFYMIMQCLGAICGAGVVKGFQGHQYEVLGGGANVVAAGYSK 78 Score = 32.3 bits (72), Expect(2) = 1e-06 Identities = 11/17 (64%), Positives = 17/17 (100%) Frame = +3 Query: 414 QGDGLGAKVIGTFVVIY 464 +GDGLGA+++GTFV++Y Sbjct: 78 KGDGLGAEIVGTFVLVY 94 >ref|XP_003532817.1| PREDICTED: probable aquaporin PIP1-2 [Glycine max] Length = 289 Score = 45.8 bits (107), Expect(2) = 2e-06 Identities = 23/41 (56%), Positives = 27/41 (65%), Gaps = 1/41 (2%) Frame = +1 Query: 298 YSLYLCLGAIYGASMVKTFKGK-QFELLSSGANFVNLSYTK 417 Y + CLGAI GA +VK F+G +EL GANFVN YTK Sbjct: 137 YIIMQCLGAICGAGVVKGFEGNANYELFKGGANFVNSGYTK 177 Score = 32.3 bits (72), Expect(2) = 2e-06 Identities = 11/17 (64%), Positives = 17/17 (100%) Frame = +3 Query: 414 QGDGLGAKVIGTFVVIY 464 +GDGLGA+++GTFV++Y Sbjct: 177 KGDGLGAEIVGTFVLVY 193 >gb|ACU24274.1| unknown [Glycine max] Length = 289 Score = 45.8 bits (107), Expect(2) = 2e-06 Identities = 23/41 (56%), Positives = 27/41 (65%), Gaps = 1/41 (2%) Frame = +1 Query: 298 YSLYLCLGAIYGASMVKTFKGK-QFELLSSGANFVNLSYTK 417 Y + CLGAI GA +VK F+G +EL GANFVN YTK Sbjct: 137 YIIMQCLGAICGAGVVKGFEGNANYELFKGGANFVNSGYTK 177 Score = 32.3 bits (72), Expect(2) = 2e-06 Identities = 11/17 (64%), Positives = 17/17 (100%) Frame = +3 Query: 414 QGDGLGAKVIGTFVVIY 464 +GDGLGA+++GTFV++Y Sbjct: 177 KGDGLGAEIVGTFVLVY 193 >dbj|BAI94500.1| plasma membrane intrinsic protein [Dianthus caryophyllus] Length = 289 Score = 45.1 bits (105), Expect(2) = 2e-06 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = +1 Query: 289 SAIYSLYLCLGAIYGASMVKTFKGKQFELLSSGANFVNLSYTK 417 + Y + CLGAI GA +VK F+ +E+L GAN VN YTK Sbjct: 131 AVFYMIMQCLGAICGAGVVKGFQPSPYEVLGGGANVVNPGYTK 173 Score = 33.1 bits (74), Expect(2) = 2e-06 Identities = 12/21 (57%), Positives = 18/21 (85%) Frame = +3 Query: 402 PELHQGDGLGAKVIGTFVVIY 464 P +GDGLGA+++GTFV++Y Sbjct: 169 PGYTKGDGLGAEIVGTFVLVY 189 >gb|AGW15994.1| plasma membrane intrinsic protein 1 [Malus domestica] Length = 286 Score = 45.8 bits (107), Expect(2) = 2e-06 Identities = 23/43 (53%), Positives = 28/43 (65%) Frame = +1 Query: 289 SAIYSLYLCLGAIYGASMVKTFKGKQFELLSSGANFVNLSYTK 417 S Y + LGA+ GA +VK F+ KQ+ELL GAN VN YTK Sbjct: 132 SVFYIIMQSLGAMAGAGVVKGFQPKQYELLGGGANAVNHGYTK 174 Score = 32.3 bits (72), Expect(2) = 2e-06 Identities = 11/17 (64%), Positives = 17/17 (100%) Frame = +3 Query: 414 QGDGLGAKVIGTFVVIY 464 +GDGLGA+++GTFV++Y Sbjct: 174 KGDGLGAEIVGTFVLVY 190 >gb|AAF80557.1|AF188844_1 plasma membrane aquaporin [Vitis vinifera] Length = 287 Score = 45.4 bits (106), Expect(2) = 2e-06 Identities = 23/41 (56%), Positives = 28/41 (68%), Gaps = 1/41 (2%) Frame = +1 Query: 298 YSLYLCLGAIYGASMVKTFKGKQ-FELLSSGANFVNLSYTK 417 Y + CLGAI GA +VK F+G Q +E+L GAN VN YTK Sbjct: 135 YIIMQCLGAICGAGVVKGFEGSQSYEVLGGGANVVNSGYTK 175 Score = 32.3 bits (72), Expect(2) = 2e-06 Identities = 11/17 (64%), Positives = 17/17 (100%) Frame = +3 Query: 414 QGDGLGAKVIGTFVVIY 464 +GDGLGA+++GTFV++Y Sbjct: 175 KGDGLGAEIVGTFVLVY 191 >ref|NP_001242504.1| uncharacterized protein LOC100793242 [Glycine max] gi|255647565|gb|ACU24246.1| unknown [Glycine max] Length = 287 Score = 45.4 bits (106), Expect(2) = 2e-06 Identities = 22/41 (53%), Positives = 28/41 (68%), Gaps = 1/41 (2%) Frame = +1 Query: 298 YSLYLCLGAIYGASMVKTFKGK-QFELLSSGANFVNLSYTK 417 Y + CLGAI GA +VK F+G ++E+ GANFVN YTK Sbjct: 135 YIIMQCLGAICGAGVVKGFEGNARYEMFKGGANFVNSGYTK 175 Score = 32.3 bits (72), Expect(2) = 2e-06 Identities = 11/17 (64%), Positives = 17/17 (100%) Frame = +3 Query: 414 QGDGLGAKVIGTFVVIY 464 +GDGLGA+++GTFV++Y Sbjct: 175 KGDGLGAEIVGTFVLVY 191 >ref|NP_001267921.1| aquaporin-like [Vitis vinifera] gi|124702509|gb|ABN14349.1| aquaporin PIP1;3 [Vitis vinifera] Length = 287 Score = 45.4 bits (106), Expect(2) = 2e-06 Identities = 23/41 (56%), Positives = 28/41 (68%), Gaps = 1/41 (2%) Frame = +1 Query: 298 YSLYLCLGAIYGASMVKTFKGKQ-FELLSSGANFVNLSYTK 417 Y + CLGAI GA +VK F+G Q +E+L GAN VN YTK Sbjct: 135 YIIMQCLGAICGAGVVKGFEGSQSYEVLGGGANVVNSGYTK 175 Score = 32.3 bits (72), Expect(2) = 2e-06 Identities = 11/17 (64%), Positives = 17/17 (100%) Frame = +3 Query: 414 QGDGLGAKVIGTFVVIY 464 +GDGLGA+++GTFV++Y Sbjct: 175 KGDGLGAEIVGTFVLVY 191 >gb|ABH09324.1| putative aquaporin [Vitis vinifera] Length = 287 Score = 45.4 bits (106), Expect(2) = 2e-06 Identities = 23/41 (56%), Positives = 28/41 (68%), Gaps = 1/41 (2%) Frame = +1 Query: 298 YSLYLCLGAIYGASMVKTFKGKQ-FELLSSGANFVNLSYTK 417 Y + CLGAI GA +VK F+G Q +E+L GAN VN YTK Sbjct: 135 YIIMQCLGAICGAGVVKGFEGSQSYEVLGGGANVVNSGYTK 175 Score = 32.3 bits (72), Expect(2) = 2e-06 Identities = 11/17 (64%), Positives = 17/17 (100%) Frame = +3 Query: 414 QGDGLGAKVIGTFVVIY 464 +GDGLGA+++GTFV++Y Sbjct: 175 KGDGLGAEIVGTFVLVY 191 >gb|AAF71819.1|AF141899_1 putative aquaporin PIP1-3 [Vitis cinerea var. helleri x Vitis rupestris] Length = 287 Score = 45.4 bits (106), Expect(2) = 2e-06 Identities = 23/41 (56%), Positives = 28/41 (68%), Gaps = 1/41 (2%) Frame = +1 Query: 298 YSLYLCLGAIYGASMVKTFKGKQ-FELLSSGANFVNLSYTK 417 Y + CLGAI GA +VK F+G Q +E+L GAN VN YTK Sbjct: 135 YIIMQCLGAICGAGVVKGFEGSQSYEVLGGGANVVNSGYTK 175 Score = 32.3 bits (72), Expect(2) = 2e-06 Identities = 11/17 (64%), Positives = 17/17 (100%) Frame = +3 Query: 414 QGDGLGAKVIGTFVVIY 464 +GDGLGA+++GTFV++Y Sbjct: 175 KGDGLGAEIVGTFVLVY 191 >gb|ACR56610.1| plasma intrinsic protein 1;1 [Juglans regia] Length = 287 Score = 45.1 bits (105), Expect(2) = 2e-06 Identities = 24/41 (58%), Positives = 27/41 (65%), Gaps = 1/41 (2%) Frame = +1 Query: 298 YSLYLCLGAIYGASMVKTF-KGKQFELLSSGANFVNLSYTK 417 Y + CLGAI GA +VK F K FE L+ GANFVN YTK Sbjct: 135 YIIMQCLGAICGAGVVKGFEKSHDFERLNGGANFVNHGYTK 175 Score = 32.7 bits (73), Expect(2) = 2e-06 Identities = 12/17 (70%), Positives = 17/17 (100%) Frame = +3 Query: 414 QGDGLGAKVIGTFVVIY 464 +GDGLGA++IGTFV++Y Sbjct: 175 KGDGLGAEIIGTFVLVY 191