BLASTX nr result
ID: Paeonia23_contig00007226
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00007226 (791 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU26502.1| hypothetical protein MIMGU_mgv1a019139mg, partial... 59 2e-06 >gb|EYU26502.1| hypothetical protein MIMGU_mgv1a019139mg, partial [Mimulus guttatus] Length = 336 Score = 59.3 bits (142), Expect = 2e-06 Identities = 29/61 (47%), Positives = 38/61 (62%) Frame = +2 Query: 413 DRLSVLPKDIQIKIVSLLPIQETVRTSLLSKKWRDAYHSVSNLIFIYHQFPEVEGKSAYF 592 DRLS LP++IQ I+ LLPI + + LLSK WR + S+ L F Y FPE+E K + Sbjct: 33 DRLSRLPQEIQSDILCLLPITDAAKVGLLSKTWRSTWLSLPKLAFDYRTFPEMEKKVKFI 92 Query: 593 D 595 D Sbjct: 93 D 93