BLASTX nr result
ID: Paeonia23_contig00007180
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00007180 (439 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002525831.1| 40S ribosomal protein S6, putative [Ricinus ... 83 3e-14 ref|XP_006355210.1| PREDICTED: 40S ribosomal protein S6-like [So... 82 1e-13 ref|XP_007227550.1| hypothetical protein PRUPE_ppa010452mg [Prun... 82 1e-13 ref|XP_004253069.1| PREDICTED: 40S ribosomal protein S6-like [So... 82 1e-13 ref|XP_004246081.1| PREDICTED: 40S ribosomal protein S6-like [So... 82 1e-13 ref|XP_004244462.1| PREDICTED: 40S ribosomal protein S6-like [So... 82 1e-13 ref|NP_001275029.1| 40S ribosomal protein S6-like [Solanum tuber... 82 1e-13 ref|NP_001274954.1| 40S ribosomal protein S6-1-like [Solanum tub... 82 1e-13 ref|XP_002273865.1| PREDICTED: 40S ribosomal protein S6 isoform ... 82 1e-13 ref|XP_002306568.1| hypothetical protein POPTR_0005s17280g [Popu... 81 1e-13 ref|XP_002271632.1| PREDICTED: 40S ribosomal protein S6 isoform ... 81 2e-13 ref|XP_002285752.1| PREDICTED: 40S ribosomal protein S6 [Vitis v... 81 2e-13 gb|EYU30988.1| hypothetical protein MIMGU_mgv1a012493mg [Mimulus... 80 2e-13 gb|EYU30987.1| hypothetical protein MIMGU_mgv1a012493mg [Mimulus... 80 2e-13 ref|XP_006466259.1| PREDICTED: 40S ribosomal protein S6-like [Ci... 80 2e-13 ref|XP_006426342.1| hypothetical protein CICLE_v10026340mg [Citr... 80 2e-13 ref|XP_006854035.1| hypothetical protein AMTR_s00048p00058600 [A... 80 2e-13 ref|XP_002302307.2| hypothetical protein POPTR_0002s09970g [Popu... 80 3e-13 ref|XP_004133785.1| PREDICTED: 40S ribosomal protein S6-like [Cu... 80 3e-13 ref|XP_002300192.1| hypothetical protein POPTR_0001s31850g [Popu... 80 3e-13 >ref|XP_002525831.1| 40S ribosomal protein S6, putative [Ricinus communis] gi|223534836|gb|EEF36525.1| 40S ribosomal protein S6, putative [Ricinus communis] Length = 197 Score = 83.2 bits (204), Expect = 3e-14 Identities = 43/46 (93%), Positives = 45/46 (97%) Frame = +3 Query: 3 AKAKSEAADYQKLLATRLKEQRDRRSESLAKKRSRLSAASKPSVTA 140 AKAKSEAADYQKLLATRLKEQR+RRSESLAKKRSRLSAASKPS+ A Sbjct: 152 AKAKSEAADYQKLLATRLKEQRERRSESLAKKRSRLSAASKPSIAA 197 >ref|XP_006355210.1| PREDICTED: 40S ribosomal protein S6-like [Solanum tuberosum] Length = 197 Score = 81.6 bits (200), Expect = 1e-13 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +3 Query: 3 AKAKSEAADYQKLLATRLKEQRDRRSESLAKKRSRLSAASKPSVTA 140 AKAKSEAADYQKLLA+RLKEQR+RRSESLAKKRSRLSAASKPS+ A Sbjct: 152 AKAKSEAADYQKLLASRLKEQRERRSESLAKKRSRLSAASKPSIAA 197 >ref|XP_007227550.1| hypothetical protein PRUPE_ppa010452mg [Prunus persica] gi|462424486|gb|EMJ28749.1| hypothetical protein PRUPE_ppa010452mg [Prunus persica] Length = 249 Score = 81.6 bits (200), Expect = 1e-13 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +3 Query: 3 AKAKSEAADYQKLLATRLKEQRDRRSESLAKKRSRLSAASKPSVTA 140 AKAKSEAA+YQKLLA+RLKEQRDRRSESLAKKRSRLSAASKPS+ A Sbjct: 204 AKAKSEAAEYQKLLASRLKEQRDRRSESLAKKRSRLSAASKPSIAA 249 >ref|XP_004253069.1| PREDICTED: 40S ribosomal protein S6-like [Solanum lycopersicum] Length = 249 Score = 81.6 bits (200), Expect = 1e-13 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +3 Query: 3 AKAKSEAADYQKLLATRLKEQRDRRSESLAKKRSRLSAASKPSVTA 140 AKAKSEAADYQKLLA+RLKEQR+RRSESLAKKRSRLSAASKPS+ A Sbjct: 204 AKAKSEAADYQKLLASRLKEQRERRSESLAKKRSRLSAASKPSIAA 249 >ref|XP_004246081.1| PREDICTED: 40S ribosomal protein S6-like [Solanum lycopersicum] Length = 249 Score = 81.6 bits (200), Expect = 1e-13 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +3 Query: 3 AKAKSEAADYQKLLATRLKEQRDRRSESLAKKRSRLSAASKPSVTA 140 AKAKSEAADYQKLLA+RLKEQR+RRSESLAKKRSRLSAASKPS+ A Sbjct: 204 AKAKSEAADYQKLLASRLKEQRERRSESLAKKRSRLSAASKPSIAA 249 >ref|XP_004244462.1| PREDICTED: 40S ribosomal protein S6-like [Solanum lycopersicum] Length = 249 Score = 81.6 bits (200), Expect = 1e-13 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +3 Query: 3 AKAKSEAADYQKLLATRLKEQRDRRSESLAKKRSRLSAASKPSVTA 140 AKAKSEAADYQKLLA+RLKEQR+RRSESLAKKRSRLSAASKPS+ A Sbjct: 204 AKAKSEAADYQKLLASRLKEQRERRSESLAKKRSRLSAASKPSIAA 249 >ref|NP_001275029.1| 40S ribosomal protein S6-like [Solanum tuberosum] gi|82623405|gb|ABB87117.1| unknown [Solanum tuberosum] Length = 249 Score = 81.6 bits (200), Expect = 1e-13 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +3 Query: 3 AKAKSEAADYQKLLATRLKEQRDRRSESLAKKRSRLSAASKPSVTA 140 AKAKSEAADYQKLLA+RLKEQR+RRSESLAKKRSRLSAASKPS+ A Sbjct: 204 AKAKSEAADYQKLLASRLKEQRERRSESLAKKRSRLSAASKPSIAA 249 >ref|NP_001274954.1| 40S ribosomal protein S6-1-like [Solanum tuberosum] gi|76161014|gb|ABA40470.1| ribosomal protein S6-like protein [Solanum tuberosum] Length = 249 Score = 81.6 bits (200), Expect = 1e-13 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +3 Query: 3 AKAKSEAADYQKLLATRLKEQRDRRSESLAKKRSRLSAASKPSVTA 140 AKAKSEAADYQKLLA+RLKEQR+RRSESLAKKRSRLSAASKPS+ A Sbjct: 204 AKAKSEAADYQKLLASRLKEQRERRSESLAKKRSRLSAASKPSIAA 249 >ref|XP_002273865.1| PREDICTED: 40S ribosomal protein S6 isoform 1 [Vitis vinifera] gi|297741825|emb|CBI33138.3| unnamed protein product [Vitis vinifera] Length = 249 Score = 81.6 bits (200), Expect = 1e-13 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +3 Query: 3 AKAKSEAADYQKLLATRLKEQRDRRSESLAKKRSRLSAASKPSVTA 140 AKAKSEAA+YQKLLATRLKEQR+RRSESLAKKRSRLSAASKPS+ A Sbjct: 204 AKAKSEAAEYQKLLATRLKEQRERRSESLAKKRSRLSAASKPSIVA 249 >ref|XP_002306568.1| hypothetical protein POPTR_0005s17280g [Populus trichocarpa] gi|118482542|gb|ABK93192.1| unknown [Populus trichocarpa] gi|222856017|gb|EEE93564.1| hypothetical protein POPTR_0005s17280g [Populus trichocarpa] Length = 249 Score = 81.3 bits (199), Expect = 1e-13 Identities = 42/46 (91%), Positives = 44/46 (95%) Frame = +3 Query: 3 AKAKSEAADYQKLLATRLKEQRDRRSESLAKKRSRLSAASKPSVTA 140 AKAKSEAA+YQKLLATRLKEQRDRRSESLAKKRSRLS ASKPS+ A Sbjct: 204 AKAKSEAAEYQKLLATRLKEQRDRRSESLAKKRSRLSIASKPSIVA 249 >ref|XP_002271632.1| PREDICTED: 40S ribosomal protein S6 isoform 1 [Vitis vinifera] gi|296087487|emb|CBI34076.3| unnamed protein product [Vitis vinifera] Length = 249 Score = 80.9 bits (198), Expect = 2e-13 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +3 Query: 3 AKAKSEAADYQKLLATRLKEQRDRRSESLAKKRSRLSAASKPSVTA 140 AKAKSEAA+YQKLLATRLKEQR+RRSESLAK+RSRLSAASKPSV A Sbjct: 204 AKAKSEAAEYQKLLATRLKEQRERRSESLAKRRSRLSAASKPSVAA 249 >ref|XP_002285752.1| PREDICTED: 40S ribosomal protein S6 [Vitis vinifera] gi|302141988|emb|CBI19191.3| unnamed protein product [Vitis vinifera] Length = 249 Score = 80.9 bits (198), Expect = 2e-13 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +3 Query: 3 AKAKSEAADYQKLLATRLKEQRDRRSESLAKKRSRLSAASKPSVTA 140 AKAKSEAA+YQKLLATRLKEQR+RRSESLAK+RSRLSAASKPSV A Sbjct: 204 AKAKSEAAEYQKLLATRLKEQRERRSESLAKRRSRLSAASKPSVAA 249 >gb|EYU30988.1| hypothetical protein MIMGU_mgv1a012493mg [Mimulus guttatus] Length = 248 Score = 80.5 bits (197), Expect = 2e-13 Identities = 41/46 (89%), Positives = 45/46 (97%) Frame = +3 Query: 3 AKAKSEAADYQKLLATRLKEQRDRRSESLAKKRSRLSAASKPSVTA 140 AKAKSEAADYQKLLA+RLKEQR++RSESLAKKRSRLSAASKPS+ A Sbjct: 203 AKAKSEAADYQKLLASRLKEQREKRSESLAKKRSRLSAASKPSIVA 248 >gb|EYU30987.1| hypothetical protein MIMGU_mgv1a012493mg [Mimulus guttatus] Length = 249 Score = 80.5 bits (197), Expect = 2e-13 Identities = 41/46 (89%), Positives = 45/46 (97%) Frame = +3 Query: 3 AKAKSEAADYQKLLATRLKEQRDRRSESLAKKRSRLSAASKPSVTA 140 AKAKSEAADYQKLLA+RLKEQR++RSESLAKKRSRLSAASKPS+ A Sbjct: 204 AKAKSEAADYQKLLASRLKEQREKRSESLAKKRSRLSAASKPSIVA 249 >ref|XP_006466259.1| PREDICTED: 40S ribosomal protein S6-like [Citrus sinensis] Length = 249 Score = 80.5 bits (197), Expect = 2e-13 Identities = 41/46 (89%), Positives = 45/46 (97%) Frame = +3 Query: 3 AKAKSEAADYQKLLATRLKEQRDRRSESLAKKRSRLSAASKPSVTA 140 AKAK+EAA+YQKLLATRLKEQR+RRSESLAKKRSRLSAASKPS+ A Sbjct: 204 AKAKAEAAEYQKLLATRLKEQRERRSESLAKKRSRLSAASKPSIAA 249 >ref|XP_006426342.1| hypothetical protein CICLE_v10026340mg [Citrus clementina] gi|557528332|gb|ESR39582.1| hypothetical protein CICLE_v10026340mg [Citrus clementina] Length = 249 Score = 80.5 bits (197), Expect = 2e-13 Identities = 41/46 (89%), Positives = 45/46 (97%) Frame = +3 Query: 3 AKAKSEAADYQKLLATRLKEQRDRRSESLAKKRSRLSAASKPSVTA 140 AKAK+EAA+YQKLLATRLKEQR+RRSESLAKKRSRLSAASKPS+ A Sbjct: 204 AKAKAEAAEYQKLLATRLKEQRERRSESLAKKRSRLSAASKPSIAA 249 >ref|XP_006854035.1| hypothetical protein AMTR_s00048p00058600 [Amborella trichopoda] gi|548857704|gb|ERN15502.1| hypothetical protein AMTR_s00048p00058600 [Amborella trichopoda] Length = 249 Score = 80.5 bits (197), Expect = 2e-13 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +3 Query: 3 AKAKSEAADYQKLLATRLKEQRDRRSESLAKKRSRLSAASKPSVTA 140 AKAKSEAA+YQKLLA+RLKEQR+RRSESLAKKRSRLSAASKPSV A Sbjct: 204 AKAKSEAAEYQKLLASRLKEQRERRSESLAKKRSRLSAASKPSVAA 249 >ref|XP_002302307.2| hypothetical protein POPTR_0002s09970g [Populus trichocarpa] gi|550344673|gb|EEE81580.2| hypothetical protein POPTR_0002s09970g [Populus trichocarpa] Length = 249 Score = 80.1 bits (196), Expect = 3e-13 Identities = 41/46 (89%), Positives = 44/46 (95%) Frame = +3 Query: 3 AKAKSEAADYQKLLATRLKEQRDRRSESLAKKRSRLSAASKPSVTA 140 AKAKSEAA+YQKLLATRLKEQR+RRSESLAKKRSRLS ASKPS+ A Sbjct: 204 AKAKSEAAEYQKLLATRLKEQRERRSESLAKKRSRLSVASKPSIAA 249 >ref|XP_004133785.1| PREDICTED: 40S ribosomal protein S6-like [Cucumis sativus] gi|449477988|ref|XP_004155185.1| PREDICTED: 40S ribosomal protein S6-like [Cucumis sativus] Length = 250 Score = 80.1 bits (196), Expect = 3e-13 Identities = 41/46 (89%), Positives = 45/46 (97%) Frame = +3 Query: 3 AKAKSEAADYQKLLATRLKEQRDRRSESLAKKRSRLSAASKPSVTA 140 AKAKSEAA+YQKLLA+RLKEQR+RRSESLAKKRSRLSAASKPS+ A Sbjct: 204 AKAKSEAAEYQKLLASRLKEQRERRSESLAKKRSRLSAASKPSIAA 249 >ref|XP_002300192.1| hypothetical protein POPTR_0001s31850g [Populus trichocarpa] gi|118482123|gb|ABK92992.1| unknown [Populus trichocarpa] gi|222847450|gb|EEE84997.1| hypothetical protein POPTR_0001s31850g [Populus trichocarpa] Length = 249 Score = 80.1 bits (196), Expect = 3e-13 Identities = 42/46 (91%), Positives = 44/46 (95%) Frame = +3 Query: 3 AKAKSEAADYQKLLATRLKEQRDRRSESLAKKRSRLSAASKPSVTA 140 AKAKSEAA+YQKLLATRLKEQR+RRSESLAKKRSRLS ASKPSV A Sbjct: 204 AKAKSEAAEYQKLLATRLKEQRERRSESLAKKRSRLSIASKPSVAA 249