BLASTX nr result
ID: Paeonia23_contig00006121
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00006121 (1411 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI39337.3| unnamed protein product [Vitis vinifera] 59 4e-06 >emb|CBI39337.3| unnamed protein product [Vitis vinifera] Length = 160 Score = 59.3 bits (142), Expect = 4e-06 Identities = 28/40 (70%), Positives = 29/40 (72%) Frame = -2 Query: 1020 NDVTSYSYGDEQHLEEALKWIFQCGLVCYLTSFYTRCSTW 901 NDV Y YGDEQHLEEALK IFQ GLV TSFY C+ W Sbjct: 75 NDVIRYRYGDEQHLEEALKRIFQYGLVGSATSFYATCNFW 114