BLASTX nr result
ID: Paeonia23_contig00005995
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00005995 (382 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007045844.1| Uncharacterized protein TCM_011518 [Theobrom... 57 4e-06 >ref|XP_007045844.1| Uncharacterized protein TCM_011518 [Theobroma cacao] gi|508709779|gb|EOY01676.1| Uncharacterized protein TCM_011518 [Theobroma cacao] Length = 409 Score = 56.6 bits (135), Expect = 4e-06 Identities = 33/87 (37%), Positives = 48/87 (55%), Gaps = 4/87 (4%) Frame = -2 Query: 354 NPFPVSCEVLTLG--GRDSSTT--CPSWRTLKELCPHPWRYLNCNLIFMQGSLYWTVSIY 187 N F + CE+LT+ G D+S C +WR L+E CPH ++ N + GSL+W + + Sbjct: 112 NNFELGCEILTISNYGTDNSIADCCSAWRMLEEGCPH---LMDANPALVNGSLHWKIDLV 168 Query: 186 GLRAGEARNIFSFNLGAKNFGRIPGPP 106 R E I SF+L A+ F +P PP Sbjct: 169 WERR-EDEQILSFDLDAEKFWILPIPP 194