BLASTX nr result
ID: Paeonia23_contig00005282
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00005282 (284 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006389594.1| hypothetical protein POPTR_0021s00450g [Popu... 46 6e-06 >ref|XP_006389594.1| hypothetical protein POPTR_0021s00450g [Populus trichocarpa] gi|550312423|gb|ERP48508.1| hypothetical protein POPTR_0021s00450g [Populus trichocarpa] Length = 528 Score = 45.8 bits (107), Expect(2) = 6e-06 Identities = 22/33 (66%), Positives = 26/33 (78%) Frame = -3 Query: 162 II*VSNNQVLAKVSSNATAATWIDLNVITYYPE 64 II V NNQ+LA SSNATAA+WI NV+ YYP+ Sbjct: 95 IISVPNNQLLAIGSSNATAASWIGKNVVAYYPQ 127 Score = 29.6 bits (65), Expect(2) = 6e-06 Identities = 15/24 (62%), Positives = 20/24 (83%), Gaps = 1/24 (4%) Frame = -2 Query: 70 P*TIIIAV-IGDKILTTVPSSALL 2 P T+I A+ +GD++LTTVPSSA L Sbjct: 126 PQTVISAIAVGDEVLTTVPSSAPL 149