BLASTX nr result
ID: Paeonia23_contig00005221
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00005221 (273 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002280022.1| PREDICTED: uncharacterized protein LOC100255... 60 3e-07 >ref|XP_002280022.1| PREDICTED: uncharacterized protein LOC100255639 [Vitis vinifera] Length = 659 Score = 60.1 bits (144), Expect = 3e-07 Identities = 34/72 (47%), Positives = 45/72 (62%), Gaps = 4/72 (5%) Frame = -2 Query: 221 NIYSYFFPNSSQPEQVHNFSPFPTQP---NITRSSNT-TIHPPELNKQPFNAKNETNSGV 54 + +S++FPNSSQ EQVHNF+ PT N TRS++ T P+ +K P AKNET Sbjct: 87 SFFSFWFPNSSQ-EQVHNFTSVPTPTTGTNATRSNDAATFQSPQKSKDPSGAKNETKVEA 145 Query: 53 LKPNQTTIHTPQ 18 L PN+T I P+ Sbjct: 146 LTPNRTAIAPPK 157