BLASTX nr result
ID: Paeonia23_contig00003051
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00003051 (373 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADD51191.1| cystatin [Vitis cinerea var. helleri x Vitis ripa... 69 9e-10 ref|XP_002283400.1| PREDICTED: cysteine proteinase inhibitor 12-... 69 9e-10 gb|ABK20185.1| cysteine protease inhibitor [Populus tomentosa] 69 9e-10 gb|ABK20187.1| cysteine protease inhibitor [Populus tomentosa] 67 2e-09 ref|XP_006373685.1| hypothetical protein POPTR_0016s03070g [Popu... 66 6e-09 gb|ABK94227.1| unknown [Populus trichocarpa] 66 6e-09 ref|XP_006430494.1| hypothetical protein CICLE_v10012693mg [Citr... 62 1e-07 ref|XP_006482025.1| PREDICTED: cysteine proteinase inhibitor 6-l... 60 3e-07 emb|CAH57560.1| cysteine protease inhibitor [Populus tremula] gi... 58 2e-06 emb|CAH57559.1| cysteine protease inhibitor [Populus tremula] 58 2e-06 gb|AAF64480.1|AF241536_1 cysteine protease inhibitor [Ipomoea ba... 57 2e-06 gb|AAD13812.1| cysteine proteinase inhibitor [Ipomoea batatas] 57 2e-06 ref|XP_002879896.1| FL3-27 [Arabidopsis lyrata subsp. lyrata] gi... 57 3e-06 ref|NP_181620.1| cysteine proteinase inhibitor 3 [Arabidopsis th... 57 3e-06 gb|AAL86314.1| putative cysteine proteinase inhibitor cystatin B... 57 3e-06 emb|CAH57550.1| cysteine protease inhibitor [Populus tremula] gi... 56 6e-06 emb|CAH57549.1| cysteine protease inhibitor [Populus tremula] gi... 56 6e-06 emb|CAH57553.1| cysteine protease inhibitor [Populus tremula] 56 6e-06 emb|CAH57562.1| cysteine protease inhibitor [Populus tremula] 56 6e-06 emb|CAH57551.1| cysteine protease inhibitor [Populus tremula] 56 6e-06 >gb|ADD51191.1| cystatin [Vitis cinerea var. helleri x Vitis riparia] Length = 234 Score = 68.6 bits (166), Expect = 9e-10 Identities = 30/48 (62%), Positives = 35/48 (72%) Frame = -1 Query: 145 QLGLCREDGILRMATRKTTLGGIHDCKGMQNSAEIEGLARFAVDEHNK 2 Q+G CRED +RM LGG+ DC G+QNSAEIE +ARFAV EHNK Sbjct: 18 QIGFCREDSFIRMPKTMNLLGGVRDCGGIQNSAEIESIARFAVQEHNK 65 >ref|XP_002283400.1| PREDICTED: cysteine proteinase inhibitor 12-like [Vitis vinifera] Length = 234 Score = 68.6 bits (166), Expect = 9e-10 Identities = 30/48 (62%), Positives = 35/48 (72%) Frame = -1 Query: 145 QLGLCREDGILRMATRKTTLGGIHDCKGMQNSAEIEGLARFAVDEHNK 2 Q+G CRED +RM LGG+ DC G+QNSAEIE +ARFAV EHNK Sbjct: 18 QIGFCREDSFIRMPKTMNLLGGVRDCGGIQNSAEIESIARFAVQEHNK 65 >gb|ABK20185.1| cysteine protease inhibitor [Populus tomentosa] Length = 138 Score = 68.6 bits (166), Expect = 9e-10 Identities = 32/50 (64%), Positives = 38/50 (76%) Frame = -1 Query: 151 FGQLGLCREDGILRMATRKTTLGGIHDCKGMQNSAEIEGLARFAVDEHNK 2 + +LGLCR+D L+M LGG+HDCKG QNSAEI+ LARFAV EHNK Sbjct: 20 YTELGLCRQDNFLKMK-----LGGVHDCKGSQNSAEIDSLARFAVQEHNK 64 >gb|ABK20187.1| cysteine protease inhibitor [Populus tomentosa] Length = 138 Score = 67.4 bits (163), Expect = 2e-09 Identities = 31/50 (62%), Positives = 38/50 (76%) Frame = -1 Query: 151 FGQLGLCREDGILRMATRKTTLGGIHDCKGMQNSAEIEGLARFAVDEHNK 2 + +LGLCR+D L+M LGG+HDC+G QNSAEI+ LARFAV EHNK Sbjct: 20 YTELGLCRQDNFLKMK-----LGGVHDCRGSQNSAEIDSLARFAVQEHNK 64 >ref|XP_006373685.1| hypothetical protein POPTR_0016s03070g [Populus trichocarpa] gi|550320704|gb|ERP51482.1| hypothetical protein POPTR_0016s03070g [Populus trichocarpa] Length = 226 Score = 65.9 bits (159), Expect = 6e-09 Identities = 31/50 (62%), Positives = 37/50 (74%) Frame = -1 Query: 151 FGQLGLCREDGILRMATRKTTLGGIHDCKGMQNSAEIEGLARFAVDEHNK 2 + +LGLC +D L+M LGG+HDCKG QNSAEI+ LARFAV EHNK Sbjct: 20 YTELGLCGQDNFLKMK-----LGGVHDCKGSQNSAEIDSLARFAVQEHNK 64 >gb|ABK94227.1| unknown [Populus trichocarpa] Length = 138 Score = 65.9 bits (159), Expect = 6e-09 Identities = 31/50 (62%), Positives = 37/50 (74%) Frame = -1 Query: 151 FGQLGLCREDGILRMATRKTTLGGIHDCKGMQNSAEIEGLARFAVDEHNK 2 + +LGLC +D L+M LGG+HDCKG QNSAEI+ LARFAV EHNK Sbjct: 20 YTELGLCGQDNFLKMK-----LGGVHDCKGSQNSAEIDSLARFAVQEHNK 64 >ref|XP_006430494.1| hypothetical protein CICLE_v10012693mg [Citrus clementina] gi|557532551|gb|ESR43734.1| hypothetical protein CICLE_v10012693mg [Citrus clementina] Length = 222 Score = 61.6 bits (148), Expect = 1e-07 Identities = 31/52 (59%), Positives = 36/52 (69%) Frame = -1 Query: 157 CSFGQLGLCREDGILRMATRKTTLGGIHDCKGMQNSAEIEGLARFAVDEHNK 2 C F +LGLCRE ++M GG++D G QNSAEIEGLARFAV EHNK Sbjct: 14 CGFIELGLCREGNFIQMRP-----GGVYDYGGNQNSAEIEGLARFAVQEHNK 60 >ref|XP_006482025.1| PREDICTED: cysteine proteinase inhibitor 6-like [Citrus sinensis] Length = 222 Score = 60.1 bits (144), Expect = 3e-07 Identities = 30/52 (57%), Positives = 35/52 (67%) Frame = -1 Query: 157 CSFGQLGLCREDGILRMATRKTTLGGIHDCKGMQNSAEIEGLARFAVDEHNK 2 C F +LGLCRE ++M GG++D G QNSAEIEGL RFAV EHNK Sbjct: 14 CGFIELGLCREGNFIQMRP-----GGVYDYGGNQNSAEIEGLGRFAVQEHNK 60 >emb|CAH57560.1| cysteine protease inhibitor [Populus tremula] gi|52851138|emb|CAH57572.1| cysteine protease inhibitor [Populus tremula] Length = 143 Score = 57.8 bits (138), Expect = 2e-06 Identities = 28/46 (60%), Positives = 33/46 (71%) Frame = -1 Query: 139 GLCREDGILRMATRKTTLGGIHDCKGMQNSAEIEGLARFAVDEHNK 2 G C+E + TTLGG+HD + QNSAEI+GLARFAVDEHNK Sbjct: 30 GFCQE--------KMTTLGGVHDSQSSQNSAEIDGLARFAVDEHNK 67 >emb|CAH57559.1| cysteine protease inhibitor [Populus tremula] Length = 143 Score = 57.8 bits (138), Expect = 2e-06 Identities = 28/46 (60%), Positives = 33/46 (71%) Frame = -1 Query: 139 GLCREDGILRMATRKTTLGGIHDCKGMQNSAEIEGLARFAVDEHNK 2 G C+E + TTLGG+HD + QNSAEI+GLARFAVDEHNK Sbjct: 30 GFCQE--------KMTTLGGVHDSQSSQNSAEIDGLARFAVDEHNK 67 >gb|AAF64480.1|AF241536_1 cysteine protease inhibitor [Ipomoea batatas] Length = 254 Score = 57.4 bits (137), Expect = 2e-06 Identities = 29/43 (67%), Positives = 33/43 (76%) Frame = -1 Query: 130 REDGILRMATRKTTLGGIHDCKGMQNSAEIEGLARFAVDEHNK 2 RED ++RMAT TTLGGI D +NS EIE LARFAV+EHNK Sbjct: 45 REDNLIRMAT--TTLGGISDSASAENSVEIESLARFAVEEHNK 85 >gb|AAD13812.1| cysteine proteinase inhibitor [Ipomoea batatas] Length = 254 Score = 57.4 bits (137), Expect = 2e-06 Identities = 29/43 (67%), Positives = 33/43 (76%) Frame = -1 Query: 130 REDGILRMATRKTTLGGIHDCKGMQNSAEIEGLARFAVDEHNK 2 RED ++RMAT TTLGGI D +NS EIE LARFAV+EHNK Sbjct: 45 REDNLIRMAT--TTLGGISDSASAENSVEIESLARFAVEEHNK 85 >ref|XP_002879896.1| FL3-27 [Arabidopsis lyrata subsp. lyrata] gi|297325735|gb|EFH56155.1| FL3-27 [Arabidopsis lyrata subsp. lyrata] Length = 125 Score = 56.6 bits (135), Expect = 3e-06 Identities = 29/53 (54%), Positives = 35/53 (66%), Gaps = 1/53 (1%) Frame = -1 Query: 157 CSFGQLGLCREDGILRMATRKTT-LGGIHDCKGMQNSAEIEGLARFAVDEHNK 2 C QL +CR + +T KT LGG+HD +G QNS EIE LARFA+ EHNK Sbjct: 14 CGTIQLAICRSE---EKSTEKTMKLGGVHDLRGNQNSGEIESLARFAIQEHNK 63 >ref|NP_181620.1| cysteine proteinase inhibitor 3 [Arabidopsis thaliana] gi|125991829|sp|Q41906.2|CYT3_ARATH RecName: Full=Cysteine proteinase inhibitor 3; Short=AtCYS-3; Flags: Precursor gi|2623302|gb|AAB86448.1| putative cysteine proteinase inhibitor B (cystatin B) [Arabidopsis thaliana] gi|21536996|gb|AAM61337.1| putative cysteine proteinase inhibitor B (cystatin B) [Arabidopsis thaliana] gi|23297693|gb|AAN13009.1| putative cysteine proteinase inhibitor B (cystatin B) [Arabidopsis thaliana] gi|330254798|gb|AEC09892.1| cysteine proteinase inhibitor 3 [Arabidopsis thaliana] Length = 125 Score = 56.6 bits (135), Expect = 3e-06 Identities = 29/53 (54%), Positives = 35/53 (66%), Gaps = 1/53 (1%) Frame = -1 Query: 157 CSFGQLGLCREDGILRMATRKTT-LGGIHDCKGMQNSAEIEGLARFAVDEHNK 2 C QL +CR + +T KT LGG+HD +G QNS EIE LARFA+ EHNK Sbjct: 14 CGTIQLAICRSE---EKSTEKTMMLGGVHDLRGNQNSGEIESLARFAIQEHNK 63 >gb|AAL86314.1| putative cysteine proteinase inhibitor cystatin B [Arabidopsis thaliana] Length = 116 Score = 56.6 bits (135), Expect = 3e-06 Identities = 29/53 (54%), Positives = 35/53 (66%), Gaps = 1/53 (1%) Frame = -1 Query: 157 CSFGQLGLCREDGILRMATRKTT-LGGIHDCKGMQNSAEIEGLARFAVDEHNK 2 C QL +CR + +T KT LGG+HD +G QNS EIE LARFA+ EHNK Sbjct: 5 CGTIQLAICRSE---EKSTEKTMMLGGVHDLRGNQNSGEIESLARFAIQEHNK 54 >emb|CAH57550.1| cysteine protease inhibitor [Populus tremula] gi|52851104|emb|CAH57555.1| cysteine protease inhibitor [Populus tremula] gi|52851142|emb|CAH57574.1| cysteine protease inhibitor [Populus tremula] Length = 143 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/46 (58%), Positives = 32/46 (69%) Frame = -1 Query: 139 GLCREDGILRMATRKTTLGGIHDCKGMQNSAEIEGLARFAVDEHNK 2 G C+E + TLGG+HD + QNSAEI+GLARFAVDEHNK Sbjct: 30 GFCQE--------KMATLGGVHDSQSSQNSAEIDGLARFAVDEHNK 67 >emb|CAH57549.1| cysteine protease inhibitor [Populus tremula] gi|52851134|emb|CAH57570.1| cysteine protease inhibitor [Populus tremula] Length = 143 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/46 (58%), Positives = 32/46 (69%) Frame = -1 Query: 139 GLCREDGILRMATRKTTLGGIHDCKGMQNSAEIEGLARFAVDEHNK 2 G C+E + TLGG+HD + QNSAEI+GLARFAVDEHNK Sbjct: 30 GFCQE--------KMATLGGVHDSQSSQNSAEIDGLARFAVDEHNK 67 >emb|CAH57553.1| cysteine protease inhibitor [Populus tremula] Length = 143 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/46 (58%), Positives = 32/46 (69%) Frame = -1 Query: 139 GLCREDGILRMATRKTTLGGIHDCKGMQNSAEIEGLARFAVDEHNK 2 G C+E + TLGG+HD + QNSAEI+GLARFAVDEHNK Sbjct: 30 GFCQE--------KMATLGGVHDSQSSQNSAEIDGLARFAVDEHNK 67 >emb|CAH57562.1| cysteine protease inhibitor [Populus tremula] Length = 143 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/46 (58%), Positives = 32/46 (69%) Frame = -1 Query: 139 GLCREDGILRMATRKTTLGGIHDCKGMQNSAEIEGLARFAVDEHNK 2 G C+E + TLGG+HD + QNSAEI+GLARFAVDEHNK Sbjct: 30 GFCQE--------KMATLGGVHDSQSSQNSAEIDGLARFAVDEHNK 67 >emb|CAH57551.1| cysteine protease inhibitor [Populus tremula] Length = 143 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/46 (58%), Positives = 32/46 (69%) Frame = -1 Query: 139 GLCREDGILRMATRKTTLGGIHDCKGMQNSAEIEGLARFAVDEHNK 2 G C+E + TLGG+HD + QNSAEI+GLARFAVDEHNK Sbjct: 30 GFCQE--------KMATLGGVHDSQSSQNSAEIDGLARFAVDEHNK 67