BLASTX nr result
ID: Paeonia23_contig00000245
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00000245 (671 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABQ65182.1| 60S ribosomal protein L19, partial [Paeonia suffr... 70 8e-10 ref|XP_006418308.1| hypothetical protein EUTSA_v10008661mg [Eutr... 59 1e-06 >gb|ABQ65182.1| 60S ribosomal protein L19, partial [Paeonia suffruticosa] Length = 90 Score = 69.7 bits (169), Expect = 8e-10 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = +2 Query: 572 RERGDEAMVSLKLQKRLSASVLKCGRGKVWLDP 670 RERGDEAMVSLKLQKRLSASVLKCGRGKVWLDP Sbjct: 1 RERGDEAMVSLKLQKRLSASVLKCGRGKVWLDP 33 >ref|XP_006418308.1| hypothetical protein EUTSA_v10008661mg [Eutrema salsugineum] gi|557096079|gb|ESQ36661.1| hypothetical protein EUTSA_v10008661mg [Eutrema salsugineum] Length = 232 Score = 58.9 bits (141), Expect = 1e-06 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = +2 Query: 575 ERGDEAMVSLKLQKRLSASVLKCGRGKVWLDP 670 ERG+ MVSLKLQKRL+ASV+KCG+GKVWLDP Sbjct: 12 ERGEAKMVSLKLQKRLAASVMKCGKGKVWLDP 43