BLASTX nr result
ID: Paeonia22_contig00047968
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00047968 (279 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN73924.1| hypothetical protein VITISV_041509 [Vitis vinifera] 51 3e-09 emb|CAN79148.1| hypothetical protein VITISV_004343 [Vitis vinifera] 51 3e-09 emb|CAN78451.1| hypothetical protein VITISV_005945 [Vitis vinifera] 51 3e-09 gb|ABF57072.1| reverse transcriptase [Prunus mume] 52 8e-09 gb|ACZ36935.1| reverse transcriptase, partial [Prunus mume] 52 8e-09 gb|ADF45881.1| reverse transcriptase [Eleocharis palustris] 54 1e-08 gb|ADF45847.1| reverse transcriptase [Eleocharis macrostachya] 53 1e-08 gb|ADF45829.1| reverse transcriptase [Eleocharis erythropoda] 53 1e-08 emb|CAN64288.1| hypothetical protein VITISV_022326 [Vitis vinifera] 51 1e-08 emb|CAN74561.1| hypothetical protein VITISV_017064 [Vitis vinifera] 54 2e-08 gb|ABF57081.1| reverse transcriptase [Prunus mume] 51 2e-08 emb|CAC37623.1| copia-like polyprotein [Arabidopsis thaliana] 52 3e-08 gb|AAD43604.1|AC005698_3 T3P18.3 [Arabidopsis thaliana] 52 3e-08 gb|AFS30564.1| reverse transcriptase, partial [Petunia x hybrida] 53 3e-08 gb|ACZ36929.1| reverse transcriptase, partial [Prunus mume] 49 4e-08 gb|ADF45830.1| reverse transcriptase [Eleocharis erythropoda] 43 4e-08 emb|CAN72498.1| hypothetical protein VITISV_010513 [Vitis vinifera] 51 4e-08 gb|ADF45803.1| reverse transcriptase [Eleocharis cellulosa] gi|2... 50 5e-08 gb|ADF45908.1| reverse transcriptase [Eleocharis quinqueflora] 50 5e-08 emb|CAN68496.1| hypothetical protein VITISV_010947 [Vitis vinifera] 50 7e-08 >emb|CAN73924.1| hypothetical protein VITISV_041509 [Vitis vinifera] Length = 1434 Score = 51.2 bits (121), Expect(2) = 3e-09 Identities = 20/33 (60%), Positives = 28/33 (84%) Frame = -2 Query: 206 FVDPNHPNHVCRLNKAICGLKQARRTWFQRLRV 108 FV+P +P +VC+L+KA+ GLKQA R WFQ+LR+ Sbjct: 989 FVNPTYPTYVCKLHKALYGLKQAPRAWFQKLRI 1021 Score = 35.4 bits (80), Expect(2) = 3e-09 Identities = 15/34 (44%), Positives = 24/34 (70%) Frame = -1 Query: 102 LLHYEFLQCKVNPSMFIFWRSTNTMVLLLYVDDM 1 LL Y F + + S+FIF +T+ ++LL+YVDD+ Sbjct: 1023 LLDYGFQSSRADTSLFIFHTATDILILLVYVDDI 1056 >emb|CAN79148.1| hypothetical protein VITISV_004343 [Vitis vinifera] Length = 1334 Score = 51.2 bits (121), Expect(2) = 3e-09 Identities = 20/33 (60%), Positives = 28/33 (84%) Frame = -2 Query: 206 FVDPNHPNHVCRLNKAICGLKQARRTWFQRLRV 108 FV+P +P +VC+L+KA+ GLKQA R WFQ+LR+ Sbjct: 989 FVNPTYPTYVCKLHKALYGLKQAPRAWFQKLRI 1021 Score = 35.4 bits (80), Expect(2) = 3e-09 Identities = 15/34 (44%), Positives = 24/34 (70%) Frame = -1 Query: 102 LLHYEFLQCKVNPSMFIFWRSTNTMVLLLYVDDM 1 LL Y F + + S+FIF +T+ ++LL+YVDD+ Sbjct: 1023 LLDYGFQSSRADTSLFIFHTATDILILLVYVDDI 1056 >emb|CAN78451.1| hypothetical protein VITISV_005945 [Vitis vinifera] Length = 773 Score = 51.2 bits (121), Expect(2) = 3e-09 Identities = 20/33 (60%), Positives = 28/33 (84%) Frame = -2 Query: 206 FVDPNHPNHVCRLNKAICGLKQARRTWFQRLRV 108 FV+P +P +VC+L+KA+ GLKQA R WFQ+LR+ Sbjct: 336 FVNPTYPTYVCKLHKALYGLKQAPRAWFQKLRI 368 Score = 35.4 bits (80), Expect(2) = 3e-09 Identities = 15/34 (44%), Positives = 24/34 (70%) Frame = -1 Query: 102 LLHYEFLQCKVNPSMFIFWRSTNTMVLLLYVDDM 1 LL Y F + + S+FIF +T+ ++LL+YVDD+ Sbjct: 370 LLDYGFQSSRADTSLFIFHTATDILILLVYVDDI 403 >gb|ABF57072.1| reverse transcriptase [Prunus mume] Length = 88 Score = 52.0 bits (123), Expect(2) = 8e-09 Identities = 21/28 (75%), Positives = 25/28 (89%) Frame = -2 Query: 206 FVDPNHPNHVCRLNKAICGLKQARRTWF 123 FVDP+HP+HVC+L+KAI GLKQA R WF Sbjct: 20 FVDPSHPHHVCKLHKAIYGLKQAPRAWF 47 Score = 33.5 bits (75), Expect(2) = 8e-09 Identities = 17/37 (45%), Positives = 23/37 (62%) Frame = -1 Query: 111 SGLLLHYEFLQCKVNPSMFIFWRSTNTMVLLLYVDDM 1 S LL F K + SMF++ + + M+LLLYVDDM Sbjct: 51 SSFLLRVGFDNSKDDSSMFVYKDAHSMMILLLYVDDM 87 >gb|ACZ36935.1| reverse transcriptase, partial [Prunus mume] Length = 88 Score = 51.6 bits (122), Expect(2) = 8e-09 Identities = 21/30 (70%), Positives = 24/30 (80%) Frame = -2 Query: 206 FVDPNHPNHVCRLNKAICGLKQARRTWFQR 117 F+DP P HVC+L+KAI GLKQA R WFQR Sbjct: 20 FIDPERPTHVCKLHKAIYGLKQAPRAWFQR 49 Score = 33.9 bits (76), Expect(2) = 8e-09 Identities = 15/34 (44%), Positives = 23/34 (67%) Frame = -1 Query: 102 LLHYEFLQCKVNPSMFIFWRSTNTMVLLLYVDDM 1 LL F+Q + + S+F++ + M+LLLYVDDM Sbjct: 54 LLQAGFIQSRSDSSLFVYRDGLSIMILLLYVDDM 87 >gb|ADF45881.1| reverse transcriptase [Eleocharis palustris] Length = 88 Score = 53.5 bits (127), Expect(2) = 1e-08 Identities = 22/32 (68%), Positives = 27/32 (84%) Frame = -2 Query: 206 FVDPNHPNHVCRLNKAICGLKQARRTWFQRLR 111 FVD N+P HVC+LNKAI GLKQA R+WF +L+ Sbjct: 20 FVDQNYPQHVCKLNKAIYGLKQAPRSWFSKLK 51 Score = 31.6 bits (70), Expect(2) = 1e-08 Identities = 13/31 (41%), Positives = 22/31 (70%) Frame = -1 Query: 93 YEFLQCKVNPSMFIFWRSTNTMVLLLYVDDM 1 ++F+ K + S+FIF S+ + +L+YVDDM Sbjct: 57 HKFVSSKADTSLFIFQSSSVLLYVLIYVDDM 87 >gb|ADF45847.1| reverse transcriptase [Eleocharis macrostachya] Length = 88 Score = 53.1 bits (126), Expect(2) = 1e-08 Identities = 23/32 (71%), Positives = 27/32 (84%) Frame = -2 Query: 206 FVDPNHPNHVCRLNKAICGLKQARRTWFQRLR 111 FVD N P+HVC+LNKAI GLKQA R+WF RL+ Sbjct: 20 FVDQNCPHHVCKLNKAIYGLKQAPRSWFSRLK 51 Score = 32.0 bits (71), Expect(2) = 1e-08 Identities = 13/31 (41%), Positives = 22/31 (70%) Frame = -1 Query: 93 YEFLQCKVNPSMFIFWRSTNTMVLLLYVDDM 1 ++F+ K + S+FIF +T + +L+YVDDM Sbjct: 57 HKFVSSKADTSLFIFQSATVLLYVLIYVDDM 87 >gb|ADF45829.1| reverse transcriptase [Eleocharis erythropoda] Length = 87 Score = 53.1 bits (126), Expect(2) = 1e-08 Identities = 23/32 (71%), Positives = 27/32 (84%) Frame = -2 Query: 206 FVDPNHPNHVCRLNKAICGLKQARRTWFQRLR 111 FVD N P+HVC+LNKAI GLKQA R+WF RL+ Sbjct: 20 FVDQNCPHHVCKLNKAIYGLKQAPRSWFSRLK 51 Score = 32.0 bits (71), Expect(2) = 1e-08 Identities = 13/31 (41%), Positives = 22/31 (70%) Frame = -1 Query: 93 YEFLQCKVNPSMFIFWRSTNTMVLLLYVDDM 1 ++F+ K + S+FIF +T + +L+YVDDM Sbjct: 57 HKFVSSKADTSLFIFQSATVLLYVLIYVDDM 87 >emb|CAN64288.1| hypothetical protein VITISV_022326 [Vitis vinifera] Length = 1508 Score = 51.2 bits (121), Expect(2) = 1e-08 Identities = 21/33 (63%), Positives = 28/33 (84%) Frame = -2 Query: 206 FVDPNHPNHVCRLNKAICGLKQARRTWFQRLRV 108 FV P +P++VC+L+KA+ GLKQA R WFQ+LRV Sbjct: 1140 FVHPQYPHYVCKLHKALYGLKQAPRAWFQKLRV 1172 Score = 33.5 bits (75), Expect(2) = 1e-08 Identities = 14/34 (41%), Positives = 24/34 (70%) Frame = -1 Query: 102 LLHYEFLQCKVNPSMFIFWRSTNTMVLLLYVDDM 1 L+ Y F +V+ S+FI ++N ++LL+YVDD+ Sbjct: 1174 LVDYGFQSSRVDTSLFIHHTASNILILLVYVDDI 1207 >emb|CAN74561.1| hypothetical protein VITISV_017064 [Vitis vinifera] Length = 801 Score = 53.5 bits (127), Expect(2) = 2e-08 Identities = 22/34 (64%), Positives = 30/34 (88%) Frame = -2 Query: 209 QFVDPNHPNHVCRLNKAICGLKQARRTWFQRLRV 108 +FV P +P++VC+L+KA+ GLKQA RTWFQ+LRV Sbjct: 339 RFVHPQYPHYVCKLHKALYGLKQAPRTWFQKLRV 372 Score = 30.4 bits (67), Expect(2) = 2e-08 Identities = 12/34 (35%), Positives = 24/34 (70%) Frame = -1 Query: 102 LLHYEFLQCKVNPSMFIFWRSTNTMVLLLYVDDM 1 L+ Y F +V+ S+FI +++ ++LL+Y+DD+ Sbjct: 374 LVDYGFQSSRVDTSLFIHHTASDILILLVYMDDI 407 >gb|ABF57081.1| reverse transcriptase [Prunus mume] Length = 88 Score = 51.2 bits (121), Expect(2) = 2e-08 Identities = 23/41 (56%), Positives = 30/41 (73%) Frame = -2 Query: 206 FVDPNHPNHVCRLNKAICGLKQARRTWFQRLRVVFFFIMSF 84 FVDP PN+VC+L+KA+ GLKQA R WF R + F++SF Sbjct: 20 FVDPTRPNYVCKLHKALYGLKQAPRAWFHR---ISSFLLSF 57 Score = 32.7 bits (73), Expect(2) = 2e-08 Identities = 16/37 (43%), Positives = 23/37 (62%) Frame = -1 Query: 111 SGLLLHYEFLQCKVNPSMFIFWRSTNTMVLLLYVDDM 1 S LL + F + + S+FIF ++ + LLLYVDDM Sbjct: 51 SSFLLSFGFQHSQSDSSLFIFRHASYVIFLLLYVDDM 87 >emb|CAC37623.1| copia-like polyprotein [Arabidopsis thaliana] Length = 1466 Score = 52.4 bits (124), Expect(2) = 3e-08 Identities = 22/28 (78%), Positives = 23/28 (82%) Frame = -2 Query: 206 FVDPNHPNHVCRLNKAICGLKQARRTWF 123 FVDPN PNHVCRL KA+ GLKQA R WF Sbjct: 1008 FVDPNKPNHVCRLTKALYGLKQAPRAWF 1035 Score = 31.2 bits (69), Expect(2) = 3e-08 Identities = 14/37 (37%), Positives = 24/37 (64%) Frame = -1 Query: 111 SGLLLHYEFLQCKVNPSMFIFWRSTNTMVLLLYVDDM 1 S LL + F +PS+F+ ++ +++LLLYVDD+ Sbjct: 1039 SNFLLDFGFECSTSDPSLFVCHQNGQSLILLLYVDDI 1075 >gb|AAD43604.1|AC005698_3 T3P18.3 [Arabidopsis thaliana] Length = 1309 Score = 52.4 bits (124), Expect(2) = 3e-08 Identities = 22/28 (78%), Positives = 23/28 (82%) Frame = -2 Query: 206 FVDPNHPNHVCRLNKAICGLKQARRTWF 123 FVDPN PNHVCRL KA+ GLKQA R WF Sbjct: 851 FVDPNKPNHVCRLTKALYGLKQAPRAWF 878 Score = 31.2 bits (69), Expect(2) = 3e-08 Identities = 14/37 (37%), Positives = 24/37 (64%) Frame = -1 Query: 111 SGLLLHYEFLQCKVNPSMFIFWRSTNTMVLLLYVDDM 1 S LL + F +PS+F+ ++ +++LLLYVDD+ Sbjct: 882 SNFLLDFGFECSTSDPSLFVCHQNGQSLILLLYVDDI 918 >gb|AFS30564.1| reverse transcriptase, partial [Petunia x hybrida] Length = 87 Score = 53.1 bits (126), Expect(2) = 3e-08 Identities = 22/36 (61%), Positives = 26/36 (72%) Frame = -2 Query: 206 FVDPNHPNHVCRLNKAICGLKQARRTWFQRLRVVFF 99 F DP +P HVCRL+KA+ GLKQA R WF+RL F Sbjct: 20 FTDPRYPTHVCRLHKALYGLKQAPRAWFERLSSALF 55 Score = 30.4 bits (67), Expect(2) = 3e-08 Identities = 15/37 (40%), Positives = 22/37 (59%) Frame = -1 Query: 111 SGLLLHYEFLQCKVNPSMFIFWRSTNTMVLLLYVDDM 1 S L Y F+ K + S+FI +T+ +L+YVDDM Sbjct: 51 SSALFEYGFVSSKSDSSLFIRKCATDVTFVLVYVDDM 87 >gb|ACZ36929.1| reverse transcriptase, partial [Prunus mume] Length = 87 Score = 49.3 bits (116), Expect(2) = 4e-08 Identities = 20/30 (66%), Positives = 23/30 (76%) Frame = -2 Query: 206 FVDPNHPNHVCRLNKAICGLKQARRTWFQR 117 F+DP P HVC+L+KAI G KQA R WFQR Sbjct: 20 FIDPQRPTHVCKLHKAIYGRKQAPRAWFQR 49 Score = 33.9 bits (76), Expect(2) = 4e-08 Identities = 15/34 (44%), Positives = 23/34 (67%) Frame = -1 Query: 102 LLHYEFLQCKVNPSMFIFWRSTNTMVLLLYVDDM 1 LL F+Q + + S+F++ + M+LLLYVDDM Sbjct: 54 LLQAGFIQSRSDSSLFVYRDGLSIMILLLYVDDM 87 >gb|ADF45830.1| reverse transcriptase [Eleocharis erythropoda] Length = 87 Score = 43.1 bits (100), Expect(2) = 4e-08 Identities = 18/32 (56%), Positives = 23/32 (71%) Frame = -2 Query: 206 FVDPNHPNHVCRLNKAICGLKQARRTWFQRLR 111 F DP +HVC L+KA+ GLKQA R WF +L+ Sbjct: 20 FEDPQFSDHVCLLHKALYGLKQAPRVWFTKLK 51 Score = 40.0 bits (92), Expect(2) = 4e-08 Identities = 18/34 (52%), Positives = 26/34 (76%) Frame = -1 Query: 102 LLHYEFLQCKVNPSMFIFWRSTNTMVLLLYVDDM 1 LLH++F+ K + S+FIF ST+ + LL+YVDDM Sbjct: 54 LLHHKFICSKADSSLFIFKNSTSFIYLLVYVDDM 87 >emb|CAN72498.1| hypothetical protein VITISV_010513 [Vitis vinifera] Length = 1394 Score = 51.2 bits (121), Expect(2) = 4e-08 Identities = 21/33 (63%), Positives = 28/33 (84%) Frame = -2 Query: 206 FVDPNHPNHVCRLNKAICGLKQARRTWFQRLRV 108 FV P +P++VC+L+KA+ GLKQA R WFQ+LRV Sbjct: 933 FVHPQYPHYVCKLHKALYGLKQAPRAWFQKLRV 965 Score = 31.6 bits (70), Expect(2) = 4e-08 Identities = 13/34 (38%), Positives = 23/34 (67%) Frame = -1 Query: 102 LLHYEFLQCKVNPSMFIFWRSTNTMVLLLYVDDM 1 L+ Y F + + S+FI ++N ++LL+YVDD+ Sbjct: 967 LVDYGFQSSRXDTSLFIHHTASNILILLVYVDDI 1000 >gb|ADF45803.1| reverse transcriptase [Eleocharis cellulosa] gi|294863707|gb|ADF45804.1| reverse transcriptase [Eleocharis cellulosa] Length = 88 Score = 50.4 bits (119), Expect(2) = 5e-08 Identities = 19/31 (61%), Positives = 26/31 (83%) Frame = -2 Query: 206 FVDPNHPNHVCRLNKAICGLKQARRTWFQRL 114 F+DP +PNHVC L+K++ GLKQA R WF++L Sbjct: 20 FIDPQYPNHVCLLHKSLYGLKQAPRAWFEKL 50 Score = 32.3 bits (72), Expect(2) = 5e-08 Identities = 15/37 (40%), Positives = 23/37 (62%) Frame = -1 Query: 111 SGLLLHYEFLQCKVNPSMFIFWRSTNTMVLLLYVDDM 1 S LL + F +PS+F+ R +T+ +L+YVDDM Sbjct: 51 STTLLSFGFKSSTYDPSLFLTHRDGHTLFVLVYVDDM 87 >gb|ADF45908.1| reverse transcriptase [Eleocharis quinqueflora] Length = 87 Score = 50.4 bits (119), Expect(2) = 5e-08 Identities = 20/31 (64%), Positives = 26/31 (83%) Frame = -2 Query: 206 FVDPNHPNHVCRLNKAICGLKQARRTWFQRL 114 F+DP+ P+HVCRL+KA+ GLKQ+ R WFQ L Sbjct: 20 FIDPSKPSHVCRLSKALYGLKQSPRAWFQTL 50 Score = 32.3 bits (72), Expect(2) = 5e-08 Identities = 15/37 (40%), Positives = 23/37 (62%) Frame = -1 Query: 111 SGLLLHYEFLQCKVNPSMFIFWRSTNTMVLLLYVDDM 1 S LL + F + +PS+F + + M+LL+YVDDM Sbjct: 51 SAALLSFGFTASRYDPSLFNYHIAGKHMILLVYVDDM 87 >emb|CAN68496.1| hypothetical protein VITISV_010947 [Vitis vinifera] Length = 1539 Score = 50.1 bits (118), Expect(2) = 7e-08 Identities = 21/33 (63%), Positives = 27/33 (81%) Frame = -2 Query: 206 FVDPNHPNHVCRLNKAICGLKQARRTWFQRLRV 108 FV P +P++VC+L KA+ GLKQA R WFQ+LRV Sbjct: 1164 FVHPQYPHYVCKLYKALYGLKQAPRVWFQKLRV 1196 Score = 32.0 bits (71), Expect(2) = 7e-08 Identities = 13/34 (38%), Positives = 23/34 (67%) Frame = -1 Query: 102 LLHYEFLQCKVNPSMFIFWRSTNTMVLLLYVDDM 1 L+ Y F + + S+FI ++N ++LL+YVDD+ Sbjct: 1198 LVDYGFQSSRADTSLFIHHTASNILILLVYVDDI 1231