BLASTX nr result
ID: Paeonia22_contig00047952
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00047952 (268 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007201093.1| hypothetical protein PRUPE_ppa026080mg, part... 61 2e-07 >ref|XP_007201093.1| hypothetical protein PRUPE_ppa026080mg, partial [Prunus persica] gi|462396493|gb|EMJ02292.1| hypothetical protein PRUPE_ppa026080mg, partial [Prunus persica] Length = 513 Score = 60.8 bits (146), Expect = 2e-07 Identities = 32/66 (48%), Positives = 47/66 (71%), Gaps = 1/66 (1%) Frame = -2 Query: 195 PVYLNIDVQAVIKGQ-VPPPTITNTEYLSIVKHMAELEEKVSALAPKDGTLSVEKEELLN 19 PVY N ++KGQ +P P I++ +Y++++K MAELEEKV+A++ K + EKE+LLN Sbjct: 407 PVYYN---GMMVKGQPLPAPAISSNDYMNMMKRMAELEEKVNAVSSKPAVMPPEKEDLLN 463 Query: 18 EATNRV 1 A NRV Sbjct: 464 VALNRV 469