BLASTX nr result
ID: Paeonia22_contig00047805
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00047805 (223 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB96783.1| hypothetical protein L484_001891 [Morus notabilis] 107 1e-21 ref|XP_007225539.1| hypothetical protein PRUPE_ppa026705mg [Prun... 107 2e-21 ref|XP_006483347.1| PREDICTED: pentatricopeptide repeat-containi... 106 3e-21 ref|XP_006483346.1| PREDICTED: pentatricopeptide repeat-containi... 106 3e-21 ref|XP_006450458.1| hypothetical protein CICLE_v10010438mg, part... 106 3e-21 ref|XP_006371932.1| hypothetical protein POPTR_0018s06450g [Popu... 106 4e-21 ref|XP_004288820.1| PREDICTED: pentatricopeptide repeat-containi... 105 7e-21 ref|XP_007203470.1| hypothetical protein PRUPE_ppa024598mg [Prun... 104 1e-20 ref|XP_006601143.1| PREDICTED: pentatricopeptide repeat-containi... 104 1e-20 ref|XP_004291465.1| PREDICTED: pentatricopeptide repeat-containi... 103 2e-20 ref|XP_003588753.1| Pentatricopeptide repeat-containing protein ... 102 4e-20 ref|XP_007161217.1| hypothetical protein PHAVU_001G0518001g, par... 102 6e-20 ref|XP_004498663.1| PREDICTED: pentatricopeptide repeat-containi... 102 6e-20 ref|XP_004975979.1| PREDICTED: pentatricopeptide repeat-containi... 101 1e-19 ref|XP_003632994.1| PREDICTED: pentatricopeptide repeat-containi... 101 1e-19 emb|CBI28140.3| unnamed protein product [Vitis vinifera] 101 1e-19 ref|XP_002448053.1| hypothetical protein SORBIDRAFT_06g020256 [S... 101 1e-19 gb|EEE55297.1| hypothetical protein OsJ_03249 [Oryza sativa Japo... 101 1e-19 gb|EEC71388.1| hypothetical protein OsI_03510 [Oryza sativa Indi... 101 1e-19 ref|XP_002281711.1| PREDICTED: pentatricopeptide repeat-containi... 101 1e-19 >gb|EXB96783.1| hypothetical protein L484_001891 [Morus notabilis] Length = 599 Score = 107 bits (268), Expect = 1e-21 Identities = 46/53 (86%), Positives = 49/53 (92%) Frame = -1 Query: 223 GMPIRVVKNLRVCSDCHAATKVISKVYNREIVVRDRNRFHHFKDGACSCKDFW 65 G PIR+VKNLRVCSDCH+ATK ISK+YNREIVVRDRNRFHHF DG CSCKDFW Sbjct: 547 GTPIRIVKNLRVCSDCHSATKFISKIYNREIVVRDRNRFHHFMDGLCSCKDFW 599 >ref|XP_007225539.1| hypothetical protein PRUPE_ppa026705mg [Prunus persica] gi|462422475|gb|EMJ26738.1| hypothetical protein PRUPE_ppa026705mg [Prunus persica] Length = 484 Score = 107 bits (267), Expect = 2e-21 Identities = 45/53 (84%), Positives = 49/53 (92%) Frame = -1 Query: 223 GMPIRVVKNLRVCSDCHAATKVISKVYNREIVVRDRNRFHHFKDGACSCKDFW 65 G PIR+VKNLRVC DCH+ATK ISK+YNREIVVRDRNRFHHFKDG CSC+DFW Sbjct: 432 GTPIRIVKNLRVCDDCHSATKFISKIYNREIVVRDRNRFHHFKDGMCSCRDFW 484 >ref|XP_006483347.1| PREDICTED: pentatricopeptide repeat-containing protein At1g59720, mitochondrial-like isoform X2 [Citrus sinensis] Length = 566 Score = 106 bits (265), Expect = 3e-21 Identities = 44/53 (83%), Positives = 51/53 (96%) Frame = -1 Query: 223 GMPIRVVKNLRVCSDCHAATKVISKVYNREIVVRDRNRFHHFKDGACSCKDFW 65 G PIR+VKNLRVC+DCH+ATK ISK+YNREIVVRDR+RFHHFKDG+CSC+DFW Sbjct: 514 GTPIRIVKNLRVCNDCHSATKFISKIYNREIVVRDRHRFHHFKDGSCSCRDFW 566 >ref|XP_006483346.1| PREDICTED: pentatricopeptide repeat-containing protein At1g59720, mitochondrial-like isoform X1 [Citrus sinensis] Length = 600 Score = 106 bits (265), Expect = 3e-21 Identities = 44/53 (83%), Positives = 51/53 (96%) Frame = -1 Query: 223 GMPIRVVKNLRVCSDCHAATKVISKVYNREIVVRDRNRFHHFKDGACSCKDFW 65 G PIR+VKNLRVC+DCH+ATK ISK+YNREIVVRDR+RFHHFKDG+CSC+DFW Sbjct: 548 GTPIRIVKNLRVCNDCHSATKFISKIYNREIVVRDRHRFHHFKDGSCSCRDFW 600 >ref|XP_006450458.1| hypothetical protein CICLE_v10010438mg, partial [Citrus clementina] gi|557553684|gb|ESR63698.1| hypothetical protein CICLE_v10010438mg, partial [Citrus clementina] Length = 629 Score = 106 bits (265), Expect = 3e-21 Identities = 44/53 (83%), Positives = 51/53 (96%) Frame = -1 Query: 223 GMPIRVVKNLRVCSDCHAATKVISKVYNREIVVRDRNRFHHFKDGACSCKDFW 65 G PIR+VKNLRVC+DCH+ATK ISK+YNREIVVRDR+RFHHFKDG+CSC+DFW Sbjct: 577 GTPIRIVKNLRVCNDCHSATKFISKIYNREIVVRDRHRFHHFKDGSCSCRDFW 629 >ref|XP_006371932.1| hypothetical protein POPTR_0018s06450g [Populus trichocarpa] gi|550318175|gb|ERP49729.1| hypothetical protein POPTR_0018s06450g [Populus trichocarpa] Length = 717 Score = 106 bits (264), Expect = 4e-21 Identities = 44/53 (83%), Positives = 50/53 (94%) Frame = -1 Query: 223 GMPIRVVKNLRVCSDCHAATKVISKVYNREIVVRDRNRFHHFKDGACSCKDFW 65 G PIRVVKNLR+CSDCH+ATK+ISK+YNREI+VRDRNRFHHFKDG CSC+ FW Sbjct: 665 GTPIRVVKNLRICSDCHSATKLISKLYNREIIVRDRNRFHHFKDGTCSCRGFW 717 >ref|XP_004288820.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Fragaria vesca subsp. vesca] Length = 659 Score = 105 bits (262), Expect = 7e-21 Identities = 46/53 (86%), Positives = 49/53 (92%) Frame = -1 Query: 223 GMPIRVVKNLRVCSDCHAATKVISKVYNREIVVRDRNRFHHFKDGACSCKDFW 65 G IRVVKNLRVCSDCH ATK+ISKVYNREI+VRDRNRFH FKDG+CSCKDFW Sbjct: 607 GTTIRVVKNLRVCSDCHTATKLISKVYNREIIVRDRNRFHQFKDGSCSCKDFW 659 >ref|XP_007203470.1| hypothetical protein PRUPE_ppa024598mg [Prunus persica] gi|462399001|gb|EMJ04669.1| hypothetical protein PRUPE_ppa024598mg [Prunus persica] Length = 722 Score = 104 bits (260), Expect = 1e-20 Identities = 45/53 (84%), Positives = 49/53 (92%) Frame = -1 Query: 223 GMPIRVVKNLRVCSDCHAATKVISKVYNREIVVRDRNRFHHFKDGACSCKDFW 65 G IRVVKNLRVCSDCH ATK+ISKVYNREI+VRDRNRFH F+DG+CSCKDFW Sbjct: 670 GTTIRVVKNLRVCSDCHTATKIISKVYNREIIVRDRNRFHRFQDGSCSCKDFW 722 >ref|XP_006601143.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like isoform X1 [Glycine max] gi|571538394|ref|XP_006601144.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like isoform X2 [Glycine max] gi|571538398|ref|XP_006601145.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like isoform X3 [Glycine max] gi|571538402|ref|XP_006601146.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like isoform X4 [Glycine max] Length = 615 Score = 104 bits (259), Expect = 1e-20 Identities = 45/53 (84%), Positives = 48/53 (90%) Frame = -1 Query: 223 GMPIRVVKNLRVCSDCHAATKVISKVYNREIVVRDRNRFHHFKDGACSCKDFW 65 G PIR+VKNLRVC DCH+ATK ISKVYNREIVVRDRNRFHHFK+G CSC DFW Sbjct: 563 GTPIRIVKNLRVCEDCHSATKFISKVYNREIVVRDRNRFHHFKNGLCSCGDFW 615 >ref|XP_004291465.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Fragaria vesca subsp. vesca] Length = 588 Score = 103 bits (258), Expect = 2e-20 Identities = 44/53 (83%), Positives = 48/53 (90%) Frame = -1 Query: 223 GMPIRVVKNLRVCSDCHAATKVISKVYNREIVVRDRNRFHHFKDGACSCKDFW 65 G PIR+VKNLRVC DCH+ATK ISK+YNREIVVRDRNRFHHFK+G CSCK FW Sbjct: 536 GTPIRIVKNLRVCEDCHSATKFISKIYNREIVVRDRNRFHHFKNGLCSCKGFW 588 >ref|XP_003588753.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355477801|gb|AES59004.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 600 Score = 102 bits (255), Expect = 4e-20 Identities = 44/53 (83%), Positives = 48/53 (90%) Frame = -1 Query: 223 GMPIRVVKNLRVCSDCHAATKVISKVYNREIVVRDRNRFHHFKDGACSCKDFW 65 G IR+VKNLRVC DCH+ATK ISKVYNREIVVRDRNRFHHFK+G CSC+DFW Sbjct: 548 GTSIRIVKNLRVCEDCHSATKFISKVYNREIVVRDRNRFHHFKNGLCSCRDFW 600 >ref|XP_007161217.1| hypothetical protein PHAVU_001G0518001g, partial [Phaseolus vulgaris] gi|561034681|gb|ESW33211.1| hypothetical protein PHAVU_001G0518001g, partial [Phaseolus vulgaris] Length = 380 Score = 102 bits (254), Expect = 6e-20 Identities = 44/53 (83%), Positives = 48/53 (90%) Frame = -1 Query: 223 GMPIRVVKNLRVCSDCHAATKVISKVYNREIVVRDRNRFHHFKDGACSCKDFW 65 G PIR+VKNLRVC DCH+ATK ISKVY+REIVVRDRNRFHHFK+G CSC DFW Sbjct: 328 GTPIRIVKNLRVCEDCHSATKFISKVYSREIVVRDRNRFHHFKNGLCSCGDFW 380 >ref|XP_004498663.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Cicer arietinum] Length = 609 Score = 102 bits (254), Expect = 6e-20 Identities = 43/53 (81%), Positives = 48/53 (90%) Frame = -1 Query: 223 GMPIRVVKNLRVCSDCHAATKVISKVYNREIVVRDRNRFHHFKDGACSCKDFW 65 G IR+VKNLR+C DCH+ATK ISKVYNREIVVRDRNRFHHFK+G CSC+DFW Sbjct: 557 GTSIRIVKNLRICEDCHSATKFISKVYNREIVVRDRNRFHHFKNGLCSCRDFW 609 >ref|XP_004975979.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Setaria italica] Length = 695 Score = 101 bits (252), Expect = 1e-19 Identities = 43/53 (81%), Positives = 49/53 (92%) Frame = -1 Query: 223 GMPIRVVKNLRVCSDCHAATKVISKVYNREIVVRDRNRFHHFKDGACSCKDFW 65 G IR+ KNLRVC+DCH+ATK+ISKVYNREIVVRDRNRFHHFKDG+CSC D+W Sbjct: 643 GTTIRLSKNLRVCTDCHSATKLISKVYNREIVVRDRNRFHHFKDGSCSCNDYW 695 >ref|XP_003632994.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Vitis vinifera] Length = 613 Score = 101 bits (251), Expect = 1e-19 Identities = 43/53 (81%), Positives = 50/53 (94%) Frame = -1 Query: 223 GMPIRVVKNLRVCSDCHAATKVISKVYNREIVVRDRNRFHHFKDGACSCKDFW 65 G+PIRVVKNLRVC+DCH A K+ISKV++REIVVRDR+RFHHFKDG CSCKD+W Sbjct: 561 GIPIRVVKNLRVCADCHLAIKLISKVFDREIVVRDRSRFHHFKDGHCSCKDYW 613 >emb|CBI28140.3| unnamed protein product [Vitis vinifera] Length = 580 Score = 101 bits (251), Expect = 1e-19 Identities = 43/53 (81%), Positives = 48/53 (90%) Frame = -1 Query: 223 GMPIRVVKNLRVCSDCHAATKVISKVYNREIVVRDRNRFHHFKDGACSCKDFW 65 G PIRVVKNLRVCSDCH+A K IS+VYNREI+VRDRNRFHHF G+CSC+DFW Sbjct: 528 GTPIRVVKNLRVCSDCHSAMKFISEVYNREIIVRDRNRFHHFTKGSCSCRDFW 580 >ref|XP_002448053.1| hypothetical protein SORBIDRAFT_06g020256 [Sorghum bicolor] gi|241939236|gb|EES12381.1| hypothetical protein SORBIDRAFT_06g020256 [Sorghum bicolor] Length = 693 Score = 101 bits (251), Expect = 1e-19 Identities = 43/53 (81%), Positives = 48/53 (90%) Frame = -1 Query: 223 GMPIRVVKNLRVCSDCHAATKVISKVYNREIVVRDRNRFHHFKDGACSCKDFW 65 G IR+ KNLRVC+DCH+ATK+ISKVYNREIVVRDRNRFHHFKDG CSC D+W Sbjct: 641 GATIRLSKNLRVCTDCHSATKLISKVYNREIVVRDRNRFHHFKDGTCSCNDYW 693 >gb|EEE55297.1| hypothetical protein OsJ_03249 [Oryza sativa Japonica Group] Length = 706 Score = 101 bits (251), Expect = 1e-19 Identities = 43/52 (82%), Positives = 48/52 (92%) Frame = -1 Query: 220 MPIRVVKNLRVCSDCHAATKVISKVYNREIVVRDRNRFHHFKDGACSCKDFW 65 M IR+VKNLRVC DCH TK+ISKV+NREIV+RDRNRFHHFKDGACSCKD+W Sbjct: 655 MEIRIVKNLRVCEDCHDYTKMISKVFNREIVMRDRNRFHHFKDGACSCKDYW 706 >gb|EEC71388.1| hypothetical protein OsI_03510 [Oryza sativa Indica Group] Length = 706 Score = 101 bits (251), Expect = 1e-19 Identities = 43/52 (82%), Positives = 48/52 (92%) Frame = -1 Query: 220 MPIRVVKNLRVCSDCHAATKVISKVYNREIVVRDRNRFHHFKDGACSCKDFW 65 M IR+VKNLRVC DCH TK+ISKV+NREIV+RDRNRFHHFKDGACSCKD+W Sbjct: 655 MEIRIVKNLRVCEDCHDYTKMISKVFNREIVMRDRNRFHHFKDGACSCKDYW 706 >ref|XP_002281711.1| PREDICTED: pentatricopeptide repeat-containing protein At2g29760, chloroplastic [Vitis vinifera] Length = 711 Score = 101 bits (251), Expect = 1e-19 Identities = 43/53 (81%), Positives = 48/53 (90%) Frame = -1 Query: 223 GMPIRVVKNLRVCSDCHAATKVISKVYNREIVVRDRNRFHHFKDGACSCKDFW 65 G PIRVVKNLRVCSDCH+A K IS+VYNREI+VRDRNRFHHF G+CSC+DFW Sbjct: 659 GTPIRVVKNLRVCSDCHSAMKFISEVYNREIIVRDRNRFHHFTKGSCSCRDFW 711