BLASTX nr result
ID: Paeonia22_contig00047673
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00047673 (242 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002523547.1| pentatricopeptide repeat-containing protein,... 64 2e-08 emb|CAN64573.1| hypothetical protein VITISV_010383 [Vitis vinifera] 61 3e-08 ref|XP_002313273.1| hypothetical protein POPTR_0009s07140g [Popu... 58 4e-08 gb|EXB63374.1| hypothetical protein L484_002623 [Morus notabilis] 51 8e-06 >ref|XP_002523547.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223537254|gb|EEF38886.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 555 Score = 64.3 bits (155), Expect = 2e-08 Identities = 32/69 (46%), Positives = 42/69 (60%), Gaps = 4/69 (5%) Frame = -3 Query: 195 YIGCSMKCMNQIFE----SWNTLFKAFSDNGYYAKVIGLFKEMKLRFGIMPNTVSVICML 28 Y+ + K +++ E SWNTL AFS NG+Y K + LF EM LR G PN V+V+ +L Sbjct: 60 YLSDAKKVFDEMLERDVVSWNTLLGAFSVNGFYLKALDLFYEMNLRSGFRPNMVTVVSVL 119 Query: 27 SVCVGLHDE 1 VC L DE Sbjct: 120 PVCAALEDE 128 >emb|CAN64573.1| hypothetical protein VITISV_010383 [Vitis vinifera] Length = 672 Score = 60.8 bits (146), Expect(2) = 3e-08 Identities = 27/51 (52%), Positives = 36/51 (70%) Frame = -3 Query: 153 SWNTLFKAFSDNGYYAKVIGLFKEMKLRFGIMPNTVSVICMLSVCVGLHDE 1 SWNT+ FS NG + +V+ LF EM+LR G+ PN VSV+ +L VC G+ DE Sbjct: 109 SWNTMIGVFSVNGCWXEVLDLFGEMRLRSGLRPNVVSVVSVLPVCAGVEDE 159 Score = 22.3 bits (46), Expect(2) = 3e-08 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = -2 Query: 211 GDLKGVYRVFDEMHEPD 161 G L+ RVFDEM E D Sbjct: 90 GGLRDAGRVFDEMPEKD 106 >ref|XP_002313273.1| hypothetical protein POPTR_0009s07140g [Populus trichocarpa] gi|222849681|gb|EEE87228.1| hypothetical protein POPTR_0009s07140g [Populus trichocarpa] Length = 680 Score = 58.2 bits (139), Expect(2) = 4e-08 Identities = 26/50 (52%), Positives = 34/50 (68%) Frame = -3 Query: 153 SWNTLFKAFSDNGYYAKVIGLFKEMKLRFGIMPNTVSVICMLSVCVGLHD 4 SWN++ FS +G+YA+ I LF EM LR G PN VS++ +L VC GL D Sbjct: 75 SWNSVIGVFSVHGFYAEAIHLFCEMNLRSGFRPNMVSIVSVLPVCAGLED 124 Score = 24.6 bits (52), Expect(2) = 4e-08 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = -2 Query: 211 GDLKGVYRVFDEMHEPD 161 G LK V RVFDEM E D Sbjct: 56 GGLKDVKRVFDEMLERD 72 >gb|EXB63374.1| hypothetical protein L484_002623 [Morus notabilis] Length = 819 Score = 51.2 bits (121), Expect(2) = 8e-06 Identities = 25/51 (49%), Positives = 32/51 (62%) Frame = -3 Query: 153 SWNTLFKAFSDNGYYAKVIGLFKEMKLRFGIMPNTVSVICMLSVCVGLHDE 1 SWNT FS NG+Y + + +KEM L PN+VSV+ +L VCV L DE Sbjct: 214 SWNTAIGVFSVNGFYLEALRCYKEMNLSV-FKPNSVSVVSVLPVCVDLEDE 263 Score = 23.9 bits (50), Expect(2) = 8e-06 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -2 Query: 211 GDLKGVYRVFDEMHEPD 161 GDL+ +VFDEM E D Sbjct: 195 GDLESARKVFDEMPERD 211