BLASTX nr result
ID: Paeonia22_contig00047608
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00047608 (398 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002268709.1| PREDICTED: RNA polymerase sigma factor rpoD ... 60 2e-07 ref|XP_006376620.1| RNA polymerase sigma subunit SigE family pro... 57 3e-06 ref|XP_007219010.1| hypothetical protein PRUPE_ppa004259mg [Prun... 55 8e-06 ref|XP_007219009.1| hypothetical protein PRUPE_ppa004259mg [Prun... 55 8e-06 >ref|XP_002268709.1| PREDICTED: RNA polymerase sigma factor rpoD [Vitis vinifera] gi|302143685|emb|CBI22546.3| unnamed protein product [Vitis vinifera] Length = 518 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/43 (60%), Positives = 33/43 (76%) Frame = -3 Query: 129 GLSAKFSTQRSPTKRPIILAFKTDKPKNIGLAAPQESIPLPLE 1 GL+AKFS ++P +RP++LAFK DK KNI L P E IPLP+E Sbjct: 18 GLNAKFSNHQTPLRRPLVLAFKADKAKNIALVTPHEPIPLPIE 60 >ref|XP_006376620.1| RNA polymerase sigma subunit SigE family protein [Populus trichocarpa] gi|550326141|gb|ERP54417.1| RNA polymerase sigma subunit SigE family protein [Populus trichocarpa] Length = 512 Score = 56.6 bits (135), Expect = 3e-06 Identities = 27/44 (61%), Positives = 31/44 (70%) Frame = -3 Query: 132 LGLSAKFSTQRSPTKRPIILAFKTDKPKNIGLAAPQESIPLPLE 1 LGLS KFST S KRP+I+AFK +K N L AP E IPLP+E Sbjct: 15 LGLSTKFSTYGSTAKRPLIVAFKANKSNNTSLVAPHEQIPLPVE 58 >ref|XP_007219010.1| hypothetical protein PRUPE_ppa004259mg [Prunus persica] gi|462415472|gb|EMJ20209.1| hypothetical protein PRUPE_ppa004259mg [Prunus persica] Length = 519 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/44 (56%), Positives = 32/44 (72%) Frame = -3 Query: 132 LGLSAKFSTQRSPTKRPIILAFKTDKPKNIGLAAPQESIPLPLE 1 LGLS K + QRS ++P+I+AFKTD+ L APQE IPLP+E Sbjct: 15 LGLSTKLTIQRSTLRKPLIVAFKTDEANKTALVAPQEKIPLPIE 58 >ref|XP_007219009.1| hypothetical protein PRUPE_ppa004259mg [Prunus persica] gi|462415471|gb|EMJ20208.1| hypothetical protein PRUPE_ppa004259mg [Prunus persica] Length = 390 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/44 (56%), Positives = 32/44 (72%) Frame = -3 Query: 132 LGLSAKFSTQRSPTKRPIILAFKTDKPKNIGLAAPQESIPLPLE 1 LGLS K + QRS ++P+I+AFKTD+ L APQE IPLP+E Sbjct: 15 LGLSTKLTIQRSTLRKPLIVAFKTDEANKTALVAPQEKIPLPIE 58