BLASTX nr result
ID: Paeonia22_contig00047281
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00047281 (275 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN61461.1| hypothetical protein VITISV_029800 [Vitis vinifera] 61 1e-07 ref|XP_003588284.1| hypothetical protein MTR_1g005250 [Medicago ... 56 6e-06 >emb|CAN61461.1| hypothetical protein VITISV_029800 [Vitis vinifera] Length = 124 Score = 61.2 bits (147), Expect = 1e-07 Identities = 35/45 (77%), Positives = 36/45 (80%), Gaps = 3/45 (6%) Frame = +2 Query: 125 MAFSDRGSLLQAPP---KVLFAFSQPLVAYVVVGIPTCSSLPPYL 250 MAFS+RGSLLQAPP KVL AFSQPLVAYVVVGIPT PP L Sbjct: 1 MAFSERGSLLQAPPNLYKVLLAFSQPLVAYVVVGIPT---TPPVL 42 >ref|XP_003588284.1| hypothetical protein MTR_1g005250 [Medicago truncatula] gi|355477332|gb|AES58535.1| hypothetical protein MTR_1g005250 [Medicago truncatula] Length = 197 Score = 55.8 bits (133), Expect = 6e-06 Identities = 33/46 (71%), Positives = 35/46 (76%), Gaps = 4/46 (8%) Frame = +2 Query: 125 MAFSDRGSLLQAPP---KVLFAFSQPLVAYVVV-GIPTCSSLPPYL 250 MAFSDRGSLLQAPP KVL AFSQP VAYVVV G+ + S PP L Sbjct: 1 MAFSDRGSLLQAPPNLYKVLLAFSQPPVAYVVVSGVGSLISTPPVL 46