BLASTX nr result
ID: Paeonia22_contig00047204
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00047204 (233 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004233864.1| PREDICTED: pentatricopeptide repeat-containi... 71 1e-10 ref|XP_007214604.1| hypothetical protein PRUPE_ppa003001mg [Prun... 70 3e-10 ref|XP_006355631.1| PREDICTED: pentatricopeptide repeat-containi... 68 1e-09 ref|XP_002272690.2| PREDICTED: pentatricopeptide repeat-containi... 65 8e-09 ref|XP_007025201.1| Pentatricopeptide repeat (PPR) superfamily p... 64 2e-08 emb|CBI30808.3| unnamed protein product [Vitis vinifera] 64 2e-08 ref|XP_004301528.1| PREDICTED: pentatricopeptide repeat-containi... 60 3e-07 ref|XP_006369868.1| hypothetical protein POPTR_0001s34330g [Popu... 60 4e-07 ref|NP_199458.1| pentatricopeptide repeat-containing protein [Ar... 56 6e-06 ref|XP_002865191.1| pentatricopeptide repeat-containing protein ... 55 8e-06 >ref|XP_004233864.1| PREDICTED: pentatricopeptide repeat-containing protein At5g46460, mitochondrial-like [Solanum lycopersicum] Length = 688 Score = 71.2 bits (173), Expect = 1e-10 Identities = 32/53 (60%), Positives = 43/53 (81%) Frame = +1 Query: 73 SIISDHLKNQRIDEACKVFNEIPYPNVYQCTKMIADYSRSYKLEDALKVFYKM 231 SI+S+HLKNQRIDEA ++F IP PN+Y CTKMIA Y+ + +L +AL++F KM Sbjct: 31 SILSEHLKNQRIDEAKELFERIPSPNIYLCTKMIAGYAENLRLNEALQLFDKM 83 >ref|XP_007214604.1| hypothetical protein PRUPE_ppa003001mg [Prunus persica] gi|462410469|gb|EMJ15803.1| hypothetical protein PRUPE_ppa003001mg [Prunus persica] Length = 613 Score = 70.1 bits (170), Expect = 3e-10 Identities = 31/53 (58%), Positives = 44/53 (83%) Frame = +1 Query: 73 SIISDHLKNQRIDEACKVFNEIPYPNVYQCTKMIADYSRSYKLEDALKVFYKM 231 S++SDHL+NQ+++EA VFNEIP+P+V T MI YSR ++L+DALK+FY+M Sbjct: 50 SLLSDHLRNQKLNEARLVFNEIPFPSVSLYTMMITGYSRQHRLDDALKLFYEM 102 >ref|XP_006355631.1| PREDICTED: pentatricopeptide repeat-containing protein At5g46460, mitochondrial-like [Solanum tuberosum] Length = 688 Score = 68.2 bits (165), Expect = 1e-09 Identities = 31/53 (58%), Positives = 41/53 (77%) Frame = +1 Query: 73 SIISDHLKNQRIDEACKVFNEIPYPNVYQCTKMIADYSRSYKLEDALKVFYKM 231 SI+SDHLKN+RIDEA ++F IP PN+Y CTKMI Y+ + +L +AL +F KM Sbjct: 31 SILSDHLKNRRIDEAKELFERIPSPNIYLCTKMIDGYAENLRLNEALTLFDKM 83 >ref|XP_002272690.2| PREDICTED: pentatricopeptide repeat-containing protein At5g46460, mitochondrial [Vitis vinifera] Length = 676 Score = 65.5 bits (158), Expect = 8e-09 Identities = 28/53 (52%), Positives = 43/53 (81%) Frame = +1 Query: 73 SIISDHLKNQRIDEACKVFNEIPYPNVYQCTKMIADYSRSYKLEDALKVFYKM 231 S+I+DHL+NQRIDEA VF+++ +P+VY T MI Y+R+Y+ + AL++FY+M Sbjct: 16 SMITDHLRNQRIDEARTVFDKVSFPDVYLYTMMITGYARNYRFDHALQLFYEM 68 >ref|XP_007025201.1| Pentatricopeptide repeat (PPR) superfamily protein [Theobroma cacao] gi|508780567|gb|EOY27823.1| Pentatricopeptide repeat (PPR) superfamily protein [Theobroma cacao] Length = 717 Score = 63.9 bits (154), Expect = 2e-08 Identities = 28/52 (53%), Positives = 41/52 (78%) Frame = +1 Query: 76 IISDHLKNQRIDEACKVFNEIPYPNVYQCTKMIADYSRSYKLEDALKVFYKM 231 ++SDHLKNQ +DEA +V N+IP+P V+ T MI Y++SY+L+DA+ +F KM Sbjct: 60 LLSDHLKNQSLDEAREVLNKIPFPGVHLYTMMIDGYAQSYRLDDAMALFEKM 111 >emb|CBI30808.3| unnamed protein product [Vitis vinifera] Length = 660 Score = 63.9 bits (154), Expect = 2e-08 Identities = 27/52 (51%), Positives = 42/52 (80%) Frame = +1 Query: 76 IISDHLKNQRIDEACKVFNEIPYPNVYQCTKMIADYSRSYKLEDALKVFYKM 231 +I+DHL+NQRIDEA VF+++ +P+VY T MI Y+R+Y+ + AL++FY+M Sbjct: 1 MITDHLRNQRIDEARTVFDKVSFPDVYLYTMMITGYARNYRFDHALQLFYEM 52 >ref|XP_004301528.1| PREDICTED: pentatricopeptide repeat-containing protein At5g46460, mitochondrial-like [Fragaria vesca subsp. vesca] Length = 577 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/53 (52%), Positives = 38/53 (71%) Frame = +1 Query: 73 SIISDHLKNQRIDEACKVFNEIPYPNVYQCTKMIADYSRSYKLEDALKVFYKM 231 S++SDHL+N R+DEA +FN IP P TKMI Y+R +L+DALK+F +M Sbjct: 47 SLLSDHLRNHRLDEAILLFNTIPSPGADMFTKMITGYARRGRLDDALKLFDEM 99 >ref|XP_006369868.1| hypothetical protein POPTR_0001s34330g [Populus trichocarpa] gi|550348837|gb|ERP66437.1| hypothetical protein POPTR_0001s34330g [Populus trichocarpa] Length = 675 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/51 (52%), Positives = 42/51 (82%) Frame = +1 Query: 79 ISDHLKNQRIDEACKVFNEIPYPNVYQCTKMIADYSRSYKLEDALKVFYKM 231 +++HLKNQR+D+A +F++IP PN++ TKMIA Y+R+ +L DALK+F +M Sbjct: 19 LANHLKNQRLDQARLIFDKIPSPNLHLYTKMIAGYTRNDRLCDALKLFDRM 69 >ref|NP_199458.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75170604|sp|Q9FHF9.1|PP419_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At5g46460, mitochondrial; Flags: Precursor gi|10177583|dbj|BAB10814.1| unnamed protein product [Arabidopsis thaliana] gi|332008005|gb|AED95388.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 697 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/52 (51%), Positives = 39/52 (75%) Frame = +1 Query: 76 IISDHLKNQRIDEACKVFNEIPYPNVYQCTKMIADYSRSYKLEDALKVFYKM 231 +I +HL ++RIDEA +VFN++P P+V TKMI Y+RS +L DAL +F +M Sbjct: 41 LICNHLLSRRIDEAREVFNQVPSPHVSLYTKMITGYTRSNRLVDALNLFDEM 92 >ref|XP_002865191.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297311026|gb|EFH41450.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 697 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/52 (50%), Positives = 40/52 (76%) Frame = +1 Query: 76 IISDHLKNQRIDEACKVFNEIPYPNVYQCTKMIADYSRSYKLEDALKVFYKM 231 +I +HL N+R+DEA +VF+++P P+V TKMI+ Y+RS +L DAL +F +M Sbjct: 41 LICNHLLNRRLDEAREVFDQVPSPHVSLYTKMISGYTRSNRLVDALNLFDEM 92