BLASTX nr result
ID: Paeonia22_contig00047069
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00047069 (267 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007204353.1| hypothetical protein PRUPE_ppa005728mg [Prun... 57 2e-06 >ref|XP_007204353.1| hypothetical protein PRUPE_ppa005728mg [Prunus persica] gi|462399884|gb|EMJ05552.1| hypothetical protein PRUPE_ppa005728mg [Prunus persica] Length = 446 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/46 (56%), Positives = 34/46 (73%) Frame = +1 Query: 130 MGENSVDTENQCAIEIWEVSKHRLASMHEKMSEPPKLLSEAAGRSS 267 MG N + E I IWEV++ RLAS+H+K+SEPP+LLS AAG+ S Sbjct: 1 MGTNPIQQETNHVIRIWEVNEDRLASIHKKISEPPRLLSNAAGKPS 46