BLASTX nr result
ID: Paeonia22_contig00047045
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00047045 (283 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EQB58737.1| hypothetical protein CGLO_00978 [Colletotrichum g... 105 8e-21 ref|XP_007590915.1| 60S ribosomal protein L29 [Colletotrichum fi... 105 8e-21 ref|XP_001550019.1| 60S ribosomal protein L29 [Botryotinia fucke... 105 8e-21 ref|XP_001591553.1| 60S ribosomal protein L29 [Sclerotinia scler... 103 2e-20 gb|EHK48379.1| hypothetical protein TRIATDRAFT_297954 [Trichoder... 103 3e-20 emb|CCX09672.1| Similar to 60S ribosomal protein L29; acc. no. P... 102 4e-20 ref|XP_957786.1| 60S ribosomal protein L29 [Neurospora crassa OR... 101 1e-19 ref|XP_002840985.1| 60S ribosomal protein L29 [Tuber melanosporu... 100 2e-19 gb|ETS83397.1| 60S ribosomal protein L29 [Pestalotiopsis fici W1... 100 2e-19 ref|XP_002792319.1| 60S ribosomal protein L29 [Paracoccidioides ... 100 2e-19 gb|EEH11222.1| conserved hypothetical protein [Ajellomyces capsu... 100 2e-19 ref|XP_001540942.1| predicted protein [Ajellomyces capsulatus NA... 100 2e-19 ref|XP_003717249.1| 60S ribosomal protein L29 [Magnaporthe oryza... 100 2e-19 ref|XP_001229506.1| 60S ribosomal protein L29 [Chaetomium globos... 100 4e-19 emb|CCT71873.1| probable ribosomal protein L29.e, cytosolic [Fus... 100 4e-19 gb|ENH73043.1| 60S ribosomal protein L29 [Fusarium oxysporum f. ... 100 4e-19 gb|EMT70368.1| 60S ribosomal protein L29, partial [Fusarium oxys... 100 4e-19 ref|XP_003233161.1| 60S ribosomal protein L29 [Trichophyton rubr... 100 4e-19 gb|EJT72657.1| 60S ribosomal protein L29 [Gaeumannomyces gramini... 99 5e-19 ref|XP_003171468.1| 60S ribosomal protein L29 [Arthroderma gypse... 99 5e-19 >gb|EQB58737.1| hypothetical protein CGLO_00978 [Colletotrichum gloeosporioides Cg-14] Length = 393 Score = 105 bits (261), Expect = 8e-21 Identities = 49/50 (98%), Positives = 49/50 (98%) Frame = +3 Query: 93 AHRNGIKKPKTSRYPSLKGTDPKIRRNHRHALHGTMKALKELKEGKRETA 242 AHRNGIKKPKTSRYPSLKGTDPK RRNHRHALHGTMKALKELKEGKRETA Sbjct: 344 AHRNGIKKPKTSRYPSLKGTDPKFRRNHRHALHGTMKALKELKEGKRETA 393 >ref|XP_007590915.1| 60S ribosomal protein L29 [Colletotrichum fioriniae PJ7] gi|310798355|gb|EFQ33248.1| ribosomal L29e family protein [Colletotrichum graminicola M1.001] gi|358380121|gb|EHK17800.1| hypothetical protein TRIVIDRAFT_88807 [Trichoderma virens Gv29-8] gi|380475206|emb|CCF45371.1| 60S ribosomal protein L29 [Colletotrichum higginsianum] gi|588905742|gb|EXF85442.1| 60S ribosomal protein L29 [Colletotrichum fioriniae PJ7] Length = 65 Score = 105 bits (261), Expect = 8e-21 Identities = 49/50 (98%), Positives = 49/50 (98%) Frame = +3 Query: 93 AHRNGIKKPKTSRYPSLKGTDPKIRRNHRHALHGTMKALKELKEGKRETA 242 AHRNGIKKPKTSRYPSLKGTDPK RRNHRHALHGTMKALKELKEGKRETA Sbjct: 16 AHRNGIKKPKTSRYPSLKGTDPKFRRNHRHALHGTMKALKELKEGKRETA 65 >ref|XP_001550019.1| 60S ribosomal protein L29 [Botryotinia fuckeliana B05.10] gi|347835053|emb|CCD49625.1| similar to 60S ribosomal protein L29 [Botryotinia fuckeliana T4] Length = 65 Score = 105 bits (261), Expect = 8e-21 Identities = 49/50 (98%), Positives = 49/50 (98%) Frame = +3 Query: 93 AHRNGIKKPKTSRYPSLKGTDPKIRRNHRHALHGTMKALKELKEGKRETA 242 AHRNGIKKPKTSRYPSLKGTDPK RRNHRHALHGTMKALKELKEGKRETA Sbjct: 16 AHRNGIKKPKTSRYPSLKGTDPKFRRNHRHALHGTMKALKELKEGKRETA 65 >ref|XP_001591553.1| 60S ribosomal protein L29 [Sclerotinia sclerotiorum 1980 UF-70] gi|154704777|gb|EDO04516.1| predicted protein [Sclerotinia sclerotiorum 1980 UF-70] Length = 65 Score = 103 bits (257), Expect = 2e-20 Identities = 48/50 (96%), Positives = 49/50 (98%) Frame = +3 Query: 93 AHRNGIKKPKTSRYPSLKGTDPKIRRNHRHALHGTMKALKELKEGKRETA 242 AHRNGIKKPKTSRYPSLKGTDPK RRNHRHALHGTMKALKELKEGKRE+A Sbjct: 16 AHRNGIKKPKTSRYPSLKGTDPKFRRNHRHALHGTMKALKELKEGKRESA 65 >gb|EHK48379.1| hypothetical protein TRIATDRAFT_297954 [Trichoderma atroviride IMI 206040] Length = 65 Score = 103 bits (256), Expect = 3e-20 Identities = 48/50 (96%), Positives = 48/50 (96%) Frame = +3 Query: 93 AHRNGIKKPKTSRYPSLKGTDPKIRRNHRHALHGTMKALKELKEGKRETA 242 AHRNGIKKPKTSRYPSL GTDPK RRNHRHALHGTMKALKELKEGKRETA Sbjct: 16 AHRNGIKKPKTSRYPSLNGTDPKFRRNHRHALHGTMKALKELKEGKRETA 65 >emb|CCX09672.1| Similar to 60S ribosomal protein L29; acc. no. P05747 [Pyronema omphalodes CBS 100304] Length = 65 Score = 102 bits (255), Expect = 4e-20 Identities = 48/50 (96%), Positives = 48/50 (96%) Frame = +3 Query: 93 AHRNGIKKPKTSRYPSLKGTDPKIRRNHRHALHGTMKALKELKEGKRETA 242 AHRNGIKKPKT RYPSLKGTDPK RRNHRHALHGTMKALKELKEGKRETA Sbjct: 16 AHRNGIKKPKTFRYPSLKGTDPKFRRNHRHALHGTMKALKELKEGKRETA 65 >ref|XP_957786.1| 60S ribosomal protein L29 [Neurospora crassa OR74A] gi|171685986|ref|XP_001907934.1| hypothetical protein [Podospora anserina S mat+] gi|28918881|gb|EAA28550.1| 60S ribosomal protein L29 [Neurospora crassa OR74A] gi|170942954|emb|CAP68607.1| unnamed protein product [Podospora anserina S mat+] gi|336469858|gb|EGO58020.1| hypothetical protein NEUTE1DRAFT_94929 [Neurospora tetrasperma FGSC 2508] gi|350290460|gb|EGZ71674.1| hypothetical protein NEUTE2DRAFT_121231 [Neurospora tetrasperma FGSC 2509] Length = 65 Score = 101 bits (251), Expect = 1e-19 Identities = 47/50 (94%), Positives = 47/50 (94%) Frame = +3 Query: 93 AHRNGIKKPKTSRYPSLKGTDPKIRRNHRHALHGTMKALKELKEGKRETA 242 AHRNGIKKPKTSRYPSLKGTDPK RRNHRHALHGT KALKE KEGKRETA Sbjct: 16 AHRNGIKKPKTSRYPSLKGTDPKFRRNHRHALHGTAKALKEFKEGKRETA 65 >ref|XP_002840985.1| 60S ribosomal protein L29 [Tuber melanosporum Mel28] gi|295637213|emb|CAZ85176.1| unnamed protein product [Tuber melanosporum] Length = 65 Score = 100 bits (250), Expect = 2e-19 Identities = 47/50 (94%), Positives = 47/50 (94%) Frame = +3 Query: 93 AHRNGIKKPKTSRYPSLKGTDPKIRRNHRHALHGTMKALKELKEGKRETA 242 AHRNGIKKPKT RYPSLKGTDPK RRNHRHALHGTM ALKELKEGKRETA Sbjct: 16 AHRNGIKKPKTYRYPSLKGTDPKFRRNHRHALHGTMNALKELKEGKRETA 65 >gb|ETS83397.1| 60S ribosomal protein L29 [Pestalotiopsis fici W106-1] Length = 65 Score = 100 bits (249), Expect = 2e-19 Identities = 47/50 (94%), Positives = 47/50 (94%) Frame = +3 Query: 93 AHRNGIKKPKTSRYPSLKGTDPKIRRNHRHALHGTMKALKELKEGKRETA 242 AHRNGIKKPKTSRYPSLKGTDPK RRNHRHALHGTMKALKE EGKRETA Sbjct: 16 AHRNGIKKPKTSRYPSLKGTDPKFRRNHRHALHGTMKALKEKAEGKRETA 65 >ref|XP_002792319.1| 60S ribosomal protein L29 [Paracoccidioides sp. 'lutzii' Pb01] gi|226278989|gb|EEH34555.1| conserved hypothetical protein [Paracoccidioides sp. 'lutzii' Pb01] Length = 65 Score = 100 bits (249), Expect = 2e-19 Identities = 46/50 (92%), Positives = 48/50 (96%) Frame = +3 Query: 93 AHRNGIKKPKTSRYPSLKGTDPKIRRNHRHALHGTMKALKELKEGKRETA 242 AHRNGIKKPKT RYPSLKGTDPK RRNHRHALHGTMKALKE+KEGKRE+A Sbjct: 16 AHRNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMKALKEVKEGKRESA 65 >gb|EEH11222.1| conserved hypothetical protein [Ajellomyces capsulatus G186AR] gi|240279767|gb|EER43272.1| conserved hypothetical protein [Ajellomyces capsulatus H143] gi|325092897|gb|EGC46207.1| conserved hypothetical protein [Ajellomyces capsulatus H88] Length = 65 Score = 100 bits (249), Expect = 2e-19 Identities = 46/50 (92%), Positives = 48/50 (96%) Frame = +3 Query: 93 AHRNGIKKPKTSRYPSLKGTDPKIRRNHRHALHGTMKALKELKEGKRETA 242 AHRNGIKKPKT RYPSLKGTDPK RRNHRHALHGTMKALKE+KEGKRE+A Sbjct: 16 AHRNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMKALKEVKEGKRESA 65 >ref|XP_001540942.1| predicted protein [Ajellomyces capsulatus NAm1] gi|150412885|gb|EDN08272.1| predicted protein [Ajellomyces capsulatus NAm1] Length = 176 Score = 100 bits (249), Expect = 2e-19 Identities = 46/50 (92%), Positives = 48/50 (96%) Frame = +3 Query: 93 AHRNGIKKPKTSRYPSLKGTDPKIRRNHRHALHGTMKALKELKEGKRETA 242 AHRNGIKKPKT RYPSLKGTDPK RRNHRHALHGTMKALKE+KEGKRE+A Sbjct: 127 AHRNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMKALKEVKEGKRESA 176 >ref|XP_003717249.1| 60S ribosomal protein L29 [Magnaporthe oryzae 70-15] gi|351643068|gb|EHA50930.1| 60S ribosomal protein L29 [Magnaporthe oryzae 70-15] gi|440475534|gb|ELQ44204.1| 60S ribosomal protein L29 [Magnaporthe oryzae Y34] gi|440478513|gb|ELQ59339.1| 60S ribosomal protein L29 [Magnaporthe oryzae P131] Length = 65 Score = 100 bits (249), Expect = 2e-19 Identities = 46/50 (92%), Positives = 47/50 (94%) Frame = +3 Query: 93 AHRNGIKKPKTSRYPSLKGTDPKIRRNHRHALHGTMKALKELKEGKRETA 242 AHRNGIKKPKTSRYPSLKGTDPK RRNHRHALHGT KA+KE KEGKRETA Sbjct: 16 AHRNGIKKPKTSRYPSLKGTDPKFRRNHRHALHGTAKAIKEFKEGKRETA 65 >ref|XP_001229506.1| 60S ribosomal protein L29 [Chaetomium globosum CBS 148.51] gi|88183587|gb|EAQ91055.1| 60S ribosomal protein L29 [Chaetomium globosum CBS 148.51] Length = 65 Score = 99.8 bits (247), Expect = 4e-19 Identities = 46/50 (92%), Positives = 46/50 (92%) Frame = +3 Query: 93 AHRNGIKKPKTSRYPSLKGTDPKIRRNHRHALHGTMKALKELKEGKRETA 242 AHRNGIKKPKT RYPSLKGTDPK RRNHRHALHGT KALKE KEGKRETA Sbjct: 16 AHRNGIKKPKTQRYPSLKGTDPKFRRNHRHALHGTAKALKEFKEGKRETA 65 >emb|CCT71873.1| probable ribosomal protein L29.e, cytosolic [Fusarium fujikuroi IMI 58289] gi|584137515|gb|EWG46861.1| 60S ribosomal protein L29 [Fusarium verticillioides 7600] gi|587664187|gb|EWY86528.1| 60S ribosomal protein L29 [Fusarium oxysporum FOSC 3-a] gi|587688560|gb|EWZ35165.1| 60S ribosomal protein L29 [Fusarium oxysporum Fo47] gi|587723407|gb|EWZ94744.1| 60S ribosomal protein L29 [Fusarium oxysporum f. sp. lycopersici MN25] gi|587741409|gb|EXA39125.1| 60S ribosomal protein L29 [Fusarium oxysporum f. sp. pisi HDV247] gi|590035951|gb|EXK37809.1| 60S ribosomal protein L29 [Fusarium oxysporum f. sp. melonis 26406] gi|590067195|gb|EXK94719.1| 60S ribosomal protein L29 [Fusarium oxysporum f. sp. raphani 54005] gi|591413743|gb|EXL48880.1| 60S ribosomal protein L29 [Fusarium oxysporum f. sp. radicis-lycopersici 26381] gi|591454004|gb|EXL86263.1| 60S ribosomal protein L29 [Fusarium oxysporum f. sp. conglutinans race 2 54008] gi|591469739|gb|EXM01066.1| 60S ribosomal protein L29 [Fusarium oxysporum f. sp. cubense tropical race 4 54006] gi|591501412|gb|EXM30796.1| 60S ribosomal protein L29 [Fusarium oxysporum f. sp. vasinfectum 25433] Length = 65 Score = 99.8 bits (247), Expect = 4e-19 Identities = 46/49 (93%), Positives = 46/49 (93%) Frame = +3 Query: 93 AHRNGIKKPKTSRYPSLKGTDPKIRRNHRHALHGTMKALKELKEGKRET 239 AHRNGIKKPKTSRYPSLKGTDPK RRNHRHALHG MKALKE KEGKRET Sbjct: 16 AHRNGIKKPKTSRYPSLKGTDPKFRRNHRHALHGNMKALKEAKEGKRET 64 >gb|ENH73043.1| 60S ribosomal protein L29 [Fusarium oxysporum f. sp. cubense race 1] Length = 141 Score = 99.8 bits (247), Expect = 4e-19 Identities = 46/49 (93%), Positives = 46/49 (93%) Frame = +3 Query: 93 AHRNGIKKPKTSRYPSLKGTDPKIRRNHRHALHGTMKALKELKEGKRET 239 AHRNGIKKPKTSRYPSLKGTDPK RRNHRHALHG MKALKE KEGKRET Sbjct: 92 AHRNGIKKPKTSRYPSLKGTDPKFRRNHRHALHGNMKALKEAKEGKRET 140 >gb|EMT70368.1| 60S ribosomal protein L29, partial [Fusarium oxysporum f. sp. cubense race 4] Length = 65 Score = 99.8 bits (247), Expect = 4e-19 Identities = 46/49 (93%), Positives = 46/49 (93%) Frame = +3 Query: 93 AHRNGIKKPKTSRYPSLKGTDPKIRRNHRHALHGTMKALKELKEGKRET 239 AHRNGIKKPKTSRYPSLKGTDPK RRNHRHALHG MKALKE KEGKRET Sbjct: 16 AHRNGIKKPKTSRYPSLKGTDPKFRRNHRHALHGNMKALKEAKEGKRET 64 >ref|XP_003233161.1| 60S ribosomal protein L29 [Trichophyton rubrum CBS 118892] gi|326464467|gb|EGD89920.1| 60S ribosomal protein L29 [Trichophyton rubrum CBS 118892] gi|607880408|gb|EZF25263.1| 60S ribosomal protein L29 [Trichophyton rubrum MR850] gi|607907085|gb|EZF44258.1| 60S ribosomal protein L29 [Trichophyton rubrum CBS 100081] gi|607919218|gb|EZF54948.1| 60S ribosomal protein L29 [Trichophyton rubrum CBS 288.86] gi|607931271|gb|EZF65566.1| 60S ribosomal protein L29 [Trichophyton rubrum CBS 289.86] gi|607955288|gb|EZF86859.1| 60S ribosomal protein L29 [Trichophyton rubrum MR1448] gi|607967496|gb|EZF97649.1| 60S ribosomal protein L29 [Trichophyton rubrum MR1459] gi|607991495|gb|EZG19185.1| 60S ribosomal protein L29 [Trichophyton rubrum CBS 202.88] Length = 65 Score = 99.8 bits (247), Expect = 4e-19 Identities = 45/50 (90%), Positives = 48/50 (96%) Frame = +3 Query: 93 AHRNGIKKPKTSRYPSLKGTDPKIRRNHRHALHGTMKALKELKEGKRETA 242 AHRNGIKKPKT RYPSLKGTDPK RRNHRHALHGTMKALKE+KEGKR++A Sbjct: 16 AHRNGIKKPKTDRYPSLKGTDPKFRRNHRHALHGTMKALKEVKEGKRDSA 65 >gb|EJT72657.1| 60S ribosomal protein L29 [Gaeumannomyces graminis var. tritici R3-111a-1] Length = 65 Score = 99.4 bits (246), Expect = 5e-19 Identities = 46/50 (92%), Positives = 46/50 (92%) Frame = +3 Query: 93 AHRNGIKKPKTSRYPSLKGTDPKIRRNHRHALHGTMKALKELKEGKRETA 242 AHRNGIKKPKTSRYPSLKG DPK RRNHRHALHGT KALKE KEGKRETA Sbjct: 16 AHRNGIKKPKTSRYPSLKGVDPKFRRNHRHALHGTAKALKEFKEGKRETA 65 >ref|XP_003171468.1| 60S ribosomal protein L29 [Arthroderma gypseum CBS 118893] gi|311343811|gb|EFR03014.1| 60S ribosomal protein L29 [Arthroderma gypseum CBS 118893] Length = 65 Score = 99.4 bits (246), Expect = 5e-19 Identities = 45/50 (90%), Positives = 48/50 (96%) Frame = +3 Query: 93 AHRNGIKKPKTSRYPSLKGTDPKIRRNHRHALHGTMKALKELKEGKRETA 242 AHRNGIKKPKT RYPSLKGTDPK RRNHRHALHGTMKALKE+KEGKR++A Sbjct: 16 AHRNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMKALKEVKEGKRDSA 65