BLASTX nr result
ID: Paeonia22_contig00047001
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00047001 (268 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007030230.1| NAC domain containing protein 47, putative i... 94 2e-17 ref|XP_007030229.1| NAC domain containing protein 47, putative i... 94 2e-17 gb|AGC97438.1| NAC protein 8 [Gossypium hirsutum] 93 4e-17 emb|CBI29915.3| unnamed protein product [Vitis vinifera] 93 4e-17 ref|XP_002282566.1| PREDICTED: NAC domain-containing protein 29-... 93 4e-17 ref|XP_006443351.1| hypothetical protein CICLE_v10020717mg [Citr... 92 8e-17 gb|ACI15346.1| NAC domain protein NAC5 [Gossypium hirsutum] gi|2... 92 8e-17 ref|XP_002325400.1| hypothetical protein POPTR_0019s04690g [Popu... 91 1e-16 ref|XP_002319143.2| hypothetical protein POPTR_0013s05080g [Popu... 91 2e-16 gb|AGL39682.1| NAC transcription factor 026 [Jatropha curcas] 91 2e-16 ref|XP_003518189.1| PREDICTED: NAC transcription factor NAM-2-li... 90 4e-16 gb|EXB37905.1| NAC domain-containing protein 18 [Morus notabilis] 89 5e-16 gb|EXB36251.1| NAC domain-containing protein 29 [Morus notabilis] 89 5e-16 gb|AGC27313.1| NAC domain protein 10 [Gossypium hirsutum] 89 5e-16 ref|XP_006408226.1| hypothetical protein EUTSA_v10021011mg [Eutr... 89 5e-16 gb|AGS08759.1| NAC domain protein [Malus hupehensis] 89 5e-16 gb|ADL36807.1| NAC domain class transcription factor [Malus dome... 89 5e-16 ref|XP_002525467.1| transcription factor, putative [Ricinus comm... 89 5e-16 ref|XP_006370307.1| no apical meristem family protein [Populus t... 89 5e-16 ref|XP_006451941.1| hypothetical protein CICLE_v10008628mg [Citr... 89 6e-16 >ref|XP_007030230.1| NAC domain containing protein 47, putative isoform 2 [Theobroma cacao] gi|508718835|gb|EOY10732.1| NAC domain containing protein 47, putative isoform 2 [Theobroma cacao] Length = 356 Score = 94.4 bits (233), Expect = 2e-17 Identities = 43/50 (86%), Positives = 46/50 (92%) Frame = +1 Query: 118 GFRFHPTDEELILHYLRKKMTSPLFSVSIIADVDIYKFDPWELPAKATFG 267 GFRFHPTDEELILHYL+KK++S F VSIIADVDIYKFDPWELPAKA FG Sbjct: 11 GFRFHPTDEELILHYLKKKLSSSPFPVSIIADVDIYKFDPWELPAKAAFG 60 >ref|XP_007030229.1| NAC domain containing protein 47, putative isoform 1 [Theobroma cacao] gi|508718834|gb|EOY10731.1| NAC domain containing protein 47, putative isoform 1 [Theobroma cacao] Length = 422 Score = 94.4 bits (233), Expect = 2e-17 Identities = 43/50 (86%), Positives = 46/50 (92%) Frame = +1 Query: 118 GFRFHPTDEELILHYLRKKMTSPLFSVSIIADVDIYKFDPWELPAKATFG 267 GFRFHPTDEELILHYL+KK++S F VSIIADVDIYKFDPWELPAKA FG Sbjct: 77 GFRFHPTDEELILHYLKKKLSSSPFPVSIIADVDIYKFDPWELPAKAAFG 126 >gb|AGC97438.1| NAC protein 8 [Gossypium hirsutum] Length = 356 Score = 92.8 bits (229), Expect = 4e-17 Identities = 42/50 (84%), Positives = 45/50 (90%) Frame = +1 Query: 118 GFRFHPTDEELILHYLRKKMTSPLFSVSIIADVDIYKFDPWELPAKATFG 267 GFRFHPTDEELILHYL+KK+TS F VSIIADVDIYKFDPW+LP KA FG Sbjct: 13 GFRFHPTDEELILHYLKKKITSSPFPVSIIADVDIYKFDPWDLPGKAAFG 62 >emb|CBI29915.3| unnamed protein product [Vitis vinifera] Length = 661 Score = 92.8 bits (229), Expect = 4e-17 Identities = 43/50 (86%), Positives = 44/50 (88%) Frame = +1 Query: 118 GFRFHPTDEELILHYLRKKMTSPLFSVSIIADVDIYKFDPWELPAKATFG 267 GFRFHPTDEELILHYL KK+TS F VSIIADVDIYKFDPWELP KA FG Sbjct: 11 GFRFHPTDEELILHYLSKKVTSTPFPVSIIADVDIYKFDPWELPGKAVFG 60 >ref|XP_002282566.1| PREDICTED: NAC domain-containing protein 29-like isoform 1 [Vitis vinifera] Length = 335 Score = 92.8 bits (229), Expect = 4e-17 Identities = 43/50 (86%), Positives = 44/50 (88%) Frame = +1 Query: 118 GFRFHPTDEELILHYLRKKMTSPLFSVSIIADVDIYKFDPWELPAKATFG 267 GFRFHPTDEELILHYL KK+TS F VSIIADVDIYKFDPWELP KA FG Sbjct: 11 GFRFHPTDEELILHYLSKKVTSTPFPVSIIADVDIYKFDPWELPGKAVFG 60 >ref|XP_006443351.1| hypothetical protein CICLE_v10020717mg [Citrus clementina] gi|568850723|ref|XP_006479050.1| PREDICTED: NAC domain-containing protein 18-like [Citrus sinensis] gi|557545613|gb|ESR56591.1| hypothetical protein CICLE_v10020717mg [Citrus clementina] Length = 368 Score = 92.0 bits (227), Expect = 8e-17 Identities = 42/50 (84%), Positives = 45/50 (90%) Frame = +1 Query: 118 GFRFHPTDEELILHYLRKKMTSPLFSVSIIADVDIYKFDPWELPAKATFG 267 GFRFHPTDEELILHYL+KK+ S F VSIIADVDIYKFDPW+LPAKA FG Sbjct: 14 GFRFHPTDEELILHYLKKKVASMPFPVSIIADVDIYKFDPWDLPAKAAFG 63 >gb|ACI15346.1| NAC domain protein NAC5 [Gossypium hirsutum] gi|206584357|gb|ACI15351.1| NAC domain protein NAC5 [Gossypium hirsutum] Length = 356 Score = 92.0 bits (227), Expect = 8e-17 Identities = 42/50 (84%), Positives = 45/50 (90%) Frame = +1 Query: 118 GFRFHPTDEELILHYLRKKMTSPLFSVSIIADVDIYKFDPWELPAKATFG 267 GFRFHPTDEELILHYL+KK+TS F VSIIADVDIYKFDPW+LP KA FG Sbjct: 13 GFRFHPTDEELILHYLKKKITSSPFPVSIIADVDIYKFDPWDLPDKAAFG 62 >ref|XP_002325400.1| hypothetical protein POPTR_0019s04690g [Populus trichocarpa] gi|222862275|gb|EEE99781.1| hypothetical protein POPTR_0019s04690g [Populus trichocarpa] Length = 367 Score = 91.3 bits (225), Expect = 1e-16 Identities = 42/50 (84%), Positives = 44/50 (88%) Frame = +1 Query: 118 GFRFHPTDEELILHYLRKKMTSPLFSVSIIADVDIYKFDPWELPAKATFG 267 GFRFHPTDEELILHYLRKK+ S F VSIIADVDIYKFDPW+LPAKA G Sbjct: 11 GFRFHPTDEELILHYLRKKVASTPFPVSIIADVDIYKFDPWDLPAKAALG 60 >ref|XP_002319143.2| hypothetical protein POPTR_0013s05080g [Populus trichocarpa] gi|550324996|gb|EEE95066.2| hypothetical protein POPTR_0013s05080g [Populus trichocarpa] Length = 368 Score = 90.9 bits (224), Expect = 2e-16 Identities = 41/50 (82%), Positives = 45/50 (90%) Frame = +1 Query: 118 GFRFHPTDEELILHYLRKKMTSPLFSVSIIADVDIYKFDPWELPAKATFG 267 GFRFHPTDEELILHYL+KK+ S F VSIIADVDIYKFDPW+LPAKA+ G Sbjct: 11 GFRFHPTDEELILHYLKKKLASTPFPVSIIADVDIYKFDPWDLPAKASLG 60 >gb|AGL39682.1| NAC transcription factor 026 [Jatropha curcas] Length = 382 Score = 90.5 bits (223), Expect = 2e-16 Identities = 41/50 (82%), Positives = 45/50 (90%) Frame = +1 Query: 118 GFRFHPTDEELILHYLRKKMTSPLFSVSIIADVDIYKFDPWELPAKATFG 267 GFRFHPTDEELILHYL+KK++S F VSIIADVDIYKFDPW+LP KA FG Sbjct: 11 GFRFHPTDEELILHYLKKKISSAPFPVSIIADVDIYKFDPWDLPDKAAFG 60 >ref|XP_003518189.1| PREDICTED: NAC transcription factor NAM-2-like [Glycine max] Length = 354 Score = 89.7 bits (221), Expect = 4e-16 Identities = 42/50 (84%), Positives = 44/50 (88%) Frame = +1 Query: 118 GFRFHPTDEELILHYLRKKMTSPLFSVSIIADVDIYKFDPWELPAKATFG 267 GFRFHPTDEELILHYLRKK+ S VSIIA+VDIYKFDPWELPAKA FG Sbjct: 12 GFRFHPTDEELILHYLRKKVASIPLPVSIIAEVDIYKFDPWELPAKAEFG 61 >gb|EXB37905.1| NAC domain-containing protein 18 [Morus notabilis] Length = 391 Score = 89.4 bits (220), Expect = 5e-16 Identities = 39/50 (78%), Positives = 45/50 (90%) Frame = +1 Query: 118 GFRFHPTDEELILHYLRKKMTSPLFSVSIIADVDIYKFDPWELPAKATFG 267 GFRFHPTDEEL++HYL+KK TS V+IIA+VD+YKFDPWELPAKATFG Sbjct: 30 GFRFHPTDEELVVHYLKKKATSAPLPVAIIAEVDLYKFDPWELPAKATFG 79 >gb|EXB36251.1| NAC domain-containing protein 29 [Morus notabilis] Length = 358 Score = 89.4 bits (220), Expect = 5e-16 Identities = 41/50 (82%), Positives = 45/50 (90%) Frame = +1 Query: 118 GFRFHPTDEELILHYLRKKMTSPLFSVSIIADVDIYKFDPWELPAKATFG 267 GFRFHPTDEELILHYLRK++ S VSIIA+VDIYKFDPW+LPAKATFG Sbjct: 11 GFRFHPTDEELILHYLRKRVISIPLPVSIIAEVDIYKFDPWDLPAKATFG 60 >gb|AGC27313.1| NAC domain protein 10 [Gossypium hirsutum] Length = 349 Score = 89.4 bits (220), Expect = 5e-16 Identities = 39/50 (78%), Positives = 45/50 (90%) Frame = +1 Query: 118 GFRFHPTDEELILHYLRKKMTSPLFSVSIIADVDIYKFDPWELPAKATFG 267 GFRFHPTDEEL++HYL+KK TS V+IIA+VD+YKFDPWELPAKATFG Sbjct: 18 GFRFHPTDEELVVHYLKKKATSAPLPVAIIAEVDLYKFDPWELPAKATFG 67 >ref|XP_006408226.1| hypothetical protein EUTSA_v10021011mg [Eutrema salsugineum] gi|557109372|gb|ESQ49679.1| hypothetical protein EUTSA_v10021011mg [Eutrema salsugineum] Length = 357 Score = 89.4 bits (220), Expect = 5e-16 Identities = 40/50 (80%), Positives = 45/50 (90%) Frame = +1 Query: 118 GFRFHPTDEELILHYLRKKMTSPLFSVSIIADVDIYKFDPWELPAKATFG 267 GFRFHPTDEELILHYLRKK++S +S+IADVDIYKFDPW+LPAKA FG Sbjct: 13 GFRFHPTDEELILHYLRKKVSSSPVPLSVIADVDIYKFDPWDLPAKAPFG 62 >gb|AGS08759.1| NAC domain protein [Malus hupehensis] Length = 364 Score = 89.4 bits (220), Expect = 5e-16 Identities = 39/50 (78%), Positives = 45/50 (90%) Frame = +1 Query: 118 GFRFHPTDEELILHYLRKKMTSPLFSVSIIADVDIYKFDPWELPAKATFG 267 GFRFHPTDEEL++HYL+KK TS V+IIA+VD+YKFDPWELPAKATFG Sbjct: 28 GFRFHPTDEELVVHYLKKKATSAPLPVAIIAEVDLYKFDPWELPAKATFG 77 >gb|ADL36807.1| NAC domain class transcription factor [Malus domestica] Length = 364 Score = 89.4 bits (220), Expect = 5e-16 Identities = 39/50 (78%), Positives = 45/50 (90%) Frame = +1 Query: 118 GFRFHPTDEELILHYLRKKMTSPLFSVSIIADVDIYKFDPWELPAKATFG 267 GFRFHPTDEEL++HYL+KK TS V+IIA+VD+YKFDPWELPAKATFG Sbjct: 28 GFRFHPTDEELVVHYLKKKATSAPLPVAIIAEVDLYKFDPWELPAKATFG 77 >ref|XP_002525467.1| transcription factor, putative [Ricinus communis] gi|223535280|gb|EEF36957.1| transcription factor, putative [Ricinus communis] Length = 365 Score = 89.4 bits (220), Expect = 5e-16 Identities = 41/50 (82%), Positives = 44/50 (88%) Frame = +1 Query: 118 GFRFHPTDEELILHYLRKKMTSPLFSVSIIADVDIYKFDPWELPAKATFG 267 GFRFHPTDEELILHYL+KK+ S F VSIIADVDIYK DPW+LPAKA FG Sbjct: 11 GFRFHPTDEELILHYLKKKIASTPFPVSIIADVDIYKSDPWDLPAKAAFG 60 >ref|XP_006370307.1| no apical meristem family protein [Populus trichocarpa] gi|550349486|gb|ERP66876.1| no apical meristem family protein [Populus trichocarpa] Length = 360 Score = 89.4 bits (220), Expect = 5e-16 Identities = 39/50 (78%), Positives = 45/50 (90%) Frame = +1 Query: 118 GFRFHPTDEELILHYLRKKMTSPLFSVSIIADVDIYKFDPWELPAKATFG 267 GFRFHPTDEEL++HYL+KK TS V+IIA+VD+YKFDPWELPAKATFG Sbjct: 31 GFRFHPTDEELVVHYLKKKTTSAPLPVAIIAEVDLYKFDPWELPAKATFG 80 >ref|XP_006451941.1| hypothetical protein CICLE_v10008628mg [Citrus clementina] gi|568820397|ref|XP_006464707.1| PREDICTED: NAC transcription factor 25-like [Citrus sinensis] gi|557555167|gb|ESR65181.1| hypothetical protein CICLE_v10008628mg [Citrus clementina] Length = 382 Score = 89.0 bits (219), Expect = 6e-16 Identities = 39/50 (78%), Positives = 45/50 (90%) Frame = +1 Query: 118 GFRFHPTDEELILHYLRKKMTSPLFSVSIIADVDIYKFDPWELPAKATFG 267 GFRFHPTDEEL++HYL+KK +S VSIIA+VD+YKFDPWELPAKATFG Sbjct: 19 GFRFHPTDEELVVHYLKKKASSAPLPVSIIAEVDLYKFDPWELPAKATFG 68