BLASTX nr result
ID: Paeonia22_contig00046921
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00046921 (290 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007142613.1| hypothetical protein PHAVU_007G002400g [Phas... 47 4e-06 ref|XP_006383506.1| hypothetical protein POPTR_0005s17500g [Popu... 42 5e-06 >ref|XP_007142613.1| hypothetical protein PHAVU_007G002400g [Phaseolus vulgaris] gi|561015803|gb|ESW14607.1| hypothetical protein PHAVU_007G002400g [Phaseolus vulgaris] Length = 870 Score = 46.6 bits (109), Expect(2) = 4e-06 Identities = 19/35 (54%), Positives = 25/35 (71%) Frame = +3 Query: 18 PPTPVAYPPHSHKAPPPEHVAPPTAQPPYSHKAPP 122 PPTPV PP+ +K+PPP +PP PPY +K+PP Sbjct: 624 PPTPVVKPPYYYKSPPPPSPSPP---PPYYYKSPP 655 Score = 29.6 bits (65), Expect(2) = 4e-06 Identities = 14/26 (53%), Positives = 17/26 (65%), Gaps = 3/26 (11%) Frame = +2 Query: 197 PPYF--APPPRY-HSIPPSSDIEAPP 265 PPY+ +PPP Y HS PP S + PP Sbjct: 695 PPYYYKSPPPYYYHSPPPPSPVVKPP 720 >ref|XP_006383506.1| hypothetical protein POPTR_0005s17500g [Populus trichocarpa] gi|550339173|gb|ERP61303.1| hypothetical protein POPTR_0005s17500g [Populus trichocarpa] Length = 596 Score = 42.4 bits (98), Expect(2) = 5e-06 Identities = 17/31 (54%), Positives = 24/31 (77%) Frame = +2 Query: 197 PPYFAPPPRYHSIPPSSDIEAPPGGGGNNHT 289 PP +A PP ++S+PPSS++ +PP GG NHT Sbjct: 463 PPVYAAPPTFNSVPPSSNVVSPPPGG--NHT 491 Score = 33.5 bits (75), Expect(2) = 5e-06 Identities = 18/43 (41%), Positives = 23/43 (53%), Gaps = 4/43 (9%) Frame = +3 Query: 9 HVAPPTPVAYPPHSHKAP----PPEHVAPPTAQPPYSHKAPPL 125 HV+PPTP+ P K P PP++ PP PP APP+ Sbjct: 426 HVSPPTPLNGPVSPPKLPPYATPPQYNIPP---PPKPSSAPPV 465