BLASTX nr result
ID: Paeonia22_contig00046689
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00046689 (316 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006485864.1| PREDICTED: pentatricopeptide repeat-containi... 59 9e-07 ref|XP_006436291.1| hypothetical protein CICLE_v10033724mg, part... 59 9e-07 ref|XP_002272525.2| PREDICTED: putative pentatricopeptide repeat... 57 3e-06 >ref|XP_006485864.1| PREDICTED: pentatricopeptide repeat-containing protein At3g26782, mitochondrial-like [Citrus sinensis] Length = 583 Score = 58.5 bits (140), Expect = 9e-07 Identities = 28/54 (51%), Positives = 42/54 (77%) Frame = +3 Query: 153 ITSLLQKQNCTSLNRLKKTHAKIYSYGLQHNTHISTKLAIFYVQFHRIDVASIL 314 +TS LQK C+SLN +KK+HAKI+ GLQ++ +I ++AIFYVQF ++D A ++ Sbjct: 16 LTSCLQK--CSSLNTVKKSHAKIFVCGLQNDNNILNQIAIFYVQFKKLDTARLV 67 >ref|XP_006436291.1| hypothetical protein CICLE_v10033724mg, partial [Citrus clementina] gi|557538487|gb|ESR49531.1| hypothetical protein CICLE_v10033724mg, partial [Citrus clementina] Length = 580 Score = 58.5 bits (140), Expect = 9e-07 Identities = 25/58 (43%), Positives = 43/58 (74%) Frame = +3 Query: 141 FPFNITSLLQKQNCTSLNRLKKTHAKIYSYGLQHNTHISTKLAIFYVQFHRIDVASIL 314 F +++++ K C+SLN +KK+HAKI+ GLQ++ +I ++AIFYVQF ++D A ++ Sbjct: 7 FLLSVSAVAAKLKCSSLNTVKKSHAKIFVCGLQNDNNILNQIAIFYVQFKKLDTARLV 64 >ref|XP_002272525.2| PREDICTED: putative pentatricopeptide repeat-containing protein At5g09950 [Vitis vinifera] Length = 1291 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/39 (66%), Positives = 33/39 (84%) Frame = +3 Query: 198 LKKTHAKIYSYGLQHNTHISTKLAIFYVQFHRIDVASIL 314 LKKTHAKI++YGLQ+++ I TK AI YV F+RID ASI+ Sbjct: 736 LKKTHAKIFAYGLQYDSRILTKFAIMYVSFNRIDAASIV 774