BLASTX nr result
ID: Paeonia22_contig00046618
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00046618 (326 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007292848.1| 4F5 domain protein [Marssonina brunnea f. sp... 73 5e-11 gb|ELR09048.1| hypothetical protein GMDG_03634 [Pseudogymnoascus... 70 4e-10 gb|EJP65137.1| 4F5 domain protein [Beauveria bassiana ARSEF 2860] 68 1e-09 emb|CCE27241.1| uncharacterized protein CPUR_00713 [Claviceps pu... 66 4e-09 ref|XP_006666989.1| Four F5 protein [Cordyceps militaris CM01] g... 66 6e-09 ref|XP_001228276.1| predicted protein [Chaetomium globosum CBS 1... 64 2e-08 gb|EMC97634.1| hypothetical protein BAUCODRAFT_42122, partial [B... 64 3e-08 gb|EFW98604.1| putative serf family protein [Grosmannia claviger... 63 4e-08 gb|EGO56491.1| hypothetical protein NEUTE1DRAFT_95261 [Neurospor... 63 5e-08 gb|EFY99319.1| 4F5 domain protein [Metarhizium anisopliae ARSEF ... 63 5e-08 ref|XP_956904.1| hypothetical protein NCU01698 [Neurospora crass... 63 5e-08 gb|EPE35948.1| putative serf family protein [Glarea lozoyensis A... 62 6e-08 gb|EHK98001.1| hypothetical protein M7I_6234 [Glarea lozoyensis ... 62 6e-08 ref|XP_007593059.1| hypothetical protein CFIO01_04530 [Colletotr... 62 8e-08 ref|XP_003004214.1| predicted protein [Verticillium alfalfae VaM... 61 1e-07 gb|ERT00026.1| hypothetical protein HMPREF1624_03395 [Sporothrix... 60 3e-07 gb|EJT69385.1| hypothetical protein GGTG_13004 [Gaeumannomyces g... 60 3e-07 ref|XP_001909478.1| hypothetical protein [Podospora anserina S m... 60 4e-07 ref|XP_003658032.1| hypothetical protein THITE_2059093 [Thielavi... 59 7e-07 ref|XP_001244750.1| predicted protein [Coccidioides immitis RS] ... 59 7e-07 >ref|XP_007292848.1| 4F5 domain protein [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] gi|406863443|gb|EKD16490.1| 4F5 domain protein [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] Length = 274 Score = 72.8 bits (177), Expect = 5e-11 Identities = 36/45 (80%), Positives = 39/45 (86%) Frame = +1 Query: 61 EMARGNQRDKAREANQKKMAEMKKSNSMSGSEMQREKEKVAAKMR 195 +MARGNQRDKAREAN KKMAE KK N+MSG+ M EKEKVAAKMR Sbjct: 113 QMARGNQRDKAREANLKKMAEQKKGNTMSGTAMAAEKEKVAAKMR 157 >gb|ELR09048.1| hypothetical protein GMDG_03634 [Pseudogymnoascus destructans 20631-21] Length = 62 Score = 69.7 bits (169), Expect = 4e-10 Identities = 35/44 (79%), Positives = 36/44 (81%) Frame = +1 Query: 64 MARGNQRDKAREANQKKMAEMKKSNSMSGSEMQREKEKVAAKMR 195 MARGNQRDKAREANQKK+A K N MSGSEM R KE VAAKMR Sbjct: 1 MARGNQRDKAREANQKKLAGQKSENKMSGSEMARTKEAVAAKMR 44 >gb|EJP65137.1| 4F5 domain protein [Beauveria bassiana ARSEF 2860] Length = 60 Score = 68.2 bits (165), Expect = 1e-09 Identities = 34/44 (77%), Positives = 36/44 (81%) Frame = +1 Query: 64 MARGNQRDKAREANQKKMAEMKKSNSMSGSEMQREKEKVAAKMR 195 MARGNQRDKAREANQKK+A KK NSMSG+EMQR KE A MR Sbjct: 1 MARGNQRDKAREANQKKLAAQKKGNSMSGTEMQRAKESAADIMR 44 >emb|CCE27241.1| uncharacterized protein CPUR_00713 [Claviceps purpurea 20.1] Length = 61 Score = 66.2 bits (160), Expect = 4e-09 Identities = 33/44 (75%), Positives = 35/44 (79%) Frame = +1 Query: 64 MARGNQRDKAREANQKKMAEMKKSNSMSGSEMQREKEKVAAKMR 195 MARGNQRDKAREA QKK+A MKK N MSG+EMQR KE A MR Sbjct: 1 MARGNQRDKAREAAQKKLASMKKGNGMSGTEMQRAKESAAEIMR 44 >ref|XP_006666989.1| Four F5 protein [Cordyceps militaris CM01] gi|346327516|gb|EGX97112.1| Four F5 protein [Cordyceps militaris CM01] Length = 106 Score = 65.9 bits (159), Expect = 6e-09 Identities = 33/44 (75%), Positives = 35/44 (79%) Frame = +1 Query: 64 MARGNQRDKAREANQKKMAEMKKSNSMSGSEMQREKEKVAAKMR 195 MARGNQRDKAREANQKK+A KK +MSGSEMQR KE A MR Sbjct: 48 MARGNQRDKAREANQKKLAGQKKGTNMSGSEMQRSKETAAEIMR 91 >ref|XP_001228276.1| predicted protein [Chaetomium globosum CBS 148.51] gi|88176477|gb|EAQ83945.1| predicted protein [Chaetomium globosum CBS 148.51] Length = 87 Score = 64.3 bits (155), Expect = 2e-08 Identities = 32/44 (72%), Positives = 35/44 (79%) Frame = +1 Query: 64 MARGNQRDKAREANQKKMAEMKKSNSMSGSEMQREKEKVAAKMR 195 MARGNQRDKAREANQKK A KKS+ MSGSE+ + KE A KMR Sbjct: 1 MARGNQRDKAREANQKKQAATKKSHGMSGSELAKAKEVAAQKMR 44 >gb|EMC97634.1| hypothetical protein BAUCODRAFT_42122, partial [Baudoinia compniacensis UAMH 10762] Length = 51 Score = 63.5 bits (153), Expect = 3e-08 Identities = 32/43 (74%), Positives = 35/43 (81%) Frame = +1 Query: 64 MARGNQRDKAREANQKKMAEMKKSNSMSGSEMQREKEKVAAKM 192 MARGNQRDKARE NQK+ A K N+M+GSE QREKEKVAA M Sbjct: 1 MARGNQRDKAREKNQKEAAGKKAKNNMTGSEFQREKEKVAAIM 43 >gb|EFW98604.1| putative serf family protein [Grosmannia clavigera kw1407] Length = 61 Score = 63.2 bits (152), Expect = 4e-08 Identities = 31/44 (70%), Positives = 35/44 (79%) Frame = +1 Query: 64 MARGNQRDKAREANQKKMAEMKKSNSMSGSEMQREKEKVAAKMR 195 MARGNQR+KARE N K+ A KK NS SGSEMQRE+E +A KMR Sbjct: 1 MARGNQREKAREKNLKQQAAQKKGNSKSGSEMQREREALALKMR 44 >gb|EGO56491.1| hypothetical protein NEUTE1DRAFT_95261 [Neurospora tetrasperma FGSC 2508] gi|350289413|gb|EGZ70638.1| four F5 protein [Neurospora tetrasperma FGSC 2509] gi|380094897|emb|CCC07399.1| unnamed protein product [Sordaria macrospora k-hell] Length = 62 Score = 62.8 bits (151), Expect = 5e-08 Identities = 31/44 (70%), Positives = 36/44 (81%) Frame = +1 Query: 64 MARGNQRDKAREANQKKMAEMKKSNSMSGSEMQREKEKVAAKMR 195 M+RGNQR+KAREAN KK A KK N+ SG+EMQR+KE VAA MR Sbjct: 1 MSRGNQREKAREANLKKQAAQKKVNNKSGTEMQRDKEAVAALMR 44 >gb|EFY99319.1| 4F5 domain protein [Metarhizium anisopliae ARSEF 23] gi|594721764|gb|EXV04651.1| 4F5 protein family protein [Metarhizium robertsii] Length = 70 Score = 62.8 bits (151), Expect = 5e-08 Identities = 31/44 (70%), Positives = 34/44 (77%) Frame = +1 Query: 64 MARGNQRDKAREANQKKMAEMKKSNSMSGSEMQREKEKVAAKMR 195 MARGNQRDKAREAN KK A KK N+M+G+EMQR KE A MR Sbjct: 1 MARGNQRDKAREANLKKQAAQKKGNTMTGTEMQRAKESAAEIMR 44 >ref|XP_956904.1| hypothetical protein NCU01698 [Neurospora crassa OR74A] gi|12718248|emb|CAC28556.1| conserved hypothetical protein [Neurospora crassa] gi|28917984|gb|EAA27668.1| 4F5 family protein [Neurospora crassa OR74A] Length = 62 Score = 62.8 bits (151), Expect = 5e-08 Identities = 31/44 (70%), Positives = 36/44 (81%) Frame = +1 Query: 64 MARGNQRDKAREANQKKMAEMKKSNSMSGSEMQREKEKVAAKMR 195 M+RGNQR+KAREAN KK A KK N+ SG+EMQR+KE VAA MR Sbjct: 1 MSRGNQREKAREANLKKQAAQKKVNTKSGTEMQRDKEAVAALMR 44 >gb|EPE35948.1| putative serf family protein [Glarea lozoyensis ATCC 20868] Length = 68 Score = 62.4 bits (150), Expect = 6e-08 Identities = 31/44 (70%), Positives = 34/44 (77%) Frame = +1 Query: 64 MARGNQRDKAREANQKKMAEMKKSNSMSGSEMQREKEKVAAKMR 195 M RGNQRDKARE K+A +K NS SGSEMQR+KE VAAKMR Sbjct: 1 MTRGNQRDKAREKAAAKLAGLKSGNSKSGSEMQRDKENVAAKMR 44 >gb|EHK98001.1| hypothetical protein M7I_6234 [Glarea lozoyensis 74030] Length = 64 Score = 62.4 bits (150), Expect = 6e-08 Identities = 31/44 (70%), Positives = 34/44 (77%) Frame = +1 Query: 64 MARGNQRDKAREANQKKMAEMKKSNSMSGSEMQREKEKVAAKMR 195 M RGNQRDKARE K+A +K NS SGSEMQR+KE VAAKMR Sbjct: 1 MTRGNQRDKAREKAAAKLAGLKSGNSKSGSEMQRDKENVAAKMR 44 >ref|XP_007593059.1| hypothetical protein CFIO01_04530 [Colletotrichum fioriniae PJ7] gi|588903097|gb|EXF83280.1| hypothetical protein CFIO01_04530 [Colletotrichum fioriniae PJ7] Length = 65 Score = 62.0 bits (149), Expect = 8e-08 Identities = 31/44 (70%), Positives = 33/44 (75%) Frame = +1 Query: 64 MARGNQRDKAREANQKKMAEMKKSNSMSGSEMQREKEKVAAKMR 195 M RGNQRDKAREA QKK A KK N+MSG+EMQR KE A MR Sbjct: 1 MTRGNQRDKAREAAQKKAASQKKGNTMSGTEMQRAKESAAEIMR 44 >ref|XP_003004214.1| predicted protein [Verticillium alfalfae VaMs.102] gi|261356790|gb|EEY19218.1| predicted protein [Verticillium alfalfae VaMs.102] gi|346972362|gb|EGY15814.1| hypothetical protein VDAG_06978 [Verticillium dahliae VdLs.17] Length = 68 Score = 61.2 bits (147), Expect = 1e-07 Identities = 30/44 (68%), Positives = 33/44 (75%) Frame = +1 Query: 64 MARGNQRDKAREANQKKMAEMKKSNSMSGSEMQREKEKVAAKMR 195 MARGNQRDKAREAN KK A MK NS SG+E+QR +E A MR Sbjct: 1 MARGNQRDKAREANLKKQAAMKSGNSQSGTELQRSRESAAEIMR 44 >gb|ERT00026.1| hypothetical protein HMPREF1624_03395 [Sporothrix schenckii ATCC 58251] Length = 62 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/44 (63%), Positives = 36/44 (81%) Frame = +1 Query: 64 MARGNQRDKAREANQKKMAEMKKSNSMSGSEMQREKEKVAAKMR 195 MARGNQRDKARE N K A KK+N+ SG+EMQR+++++A KMR Sbjct: 1 MARGNQRDKAREKNLKAQAGQKKANTKSGTEMQRDRDELAKKMR 44 >gb|EJT69385.1| hypothetical protein GGTG_13004 [Gaeumannomyces graminis var. tritici R3-111a-1] Length = 59 Score = 60.1 bits (144), Expect = 3e-07 Identities = 30/44 (68%), Positives = 33/44 (75%) Frame = +1 Query: 64 MARGNQRDKAREANQKKMAEMKKSNSMSGSEMQREKEKVAAKMR 195 MARGNQRDKARE N K+ A+ K N SGSEM R+KEKVA MR Sbjct: 1 MARGNQRDKAREKNLKEQAKKKAGNGKSGSEMARDKEKVAEMMR 44 >ref|XP_001909478.1| hypothetical protein [Podospora anserina S mat+] gi|170944500|emb|CAP70611.1| unnamed protein product [Podospora anserina S mat+] Length = 63 Score = 59.7 bits (143), Expect = 4e-07 Identities = 30/44 (68%), Positives = 34/44 (77%) Frame = +1 Query: 64 MARGNQRDKAREANQKKMAEMKKSNSMSGSEMQREKEKVAAKMR 195 MARGNQRDKAREA QKK A KK ++MSGSE+ + KE A KMR Sbjct: 1 MARGNQRDKAREAAQKKAAAQKKGHNMSGSELAKAKEIAAQKMR 44 >ref|XP_003658032.1| hypothetical protein THITE_2059093 [Thielavia terrestris NRRL 8126] gi|347005298|gb|AEO71696.1| hypothetical protein THITE_2059093 [Thielavia terrestris NRRL 8126] Length = 64 Score = 58.9 bits (141), Expect = 7e-07 Identities = 28/44 (63%), Positives = 35/44 (79%) Frame = +1 Query: 64 MARGNQRDKAREANQKKMAEMKKSNSMSGSEMQREKEKVAAKMR 195 M+RGNQR+KAREA QKK+A KK++ MSGSE+ + KE A KMR Sbjct: 1 MSRGNQREKAREATQKKLAAQKKAHGMSGSELAKAKEIAAQKMR 44 >ref|XP_001244750.1| predicted protein [Coccidioides immitis RS] gi|303316424|ref|XP_003068214.1| hypothetical protein CPC735_002360 [Coccidioides posadasii C735 delta SOWgp] gi|240107895|gb|EER26069.1| hypothetical protein CPC735_002360 [Coccidioides posadasii C735 delta SOWgp] gi|320037961|gb|EFW19897.1| conserved hypothetical protein [Coccidioides posadasii str. Silveira] gi|392871462|gb|EAS33380.2| hypothetical protein CIMG_04191 [Coccidioides immitis RS] Length = 65 Score = 58.9 bits (141), Expect = 7e-07 Identities = 29/44 (65%), Positives = 34/44 (77%) Frame = +1 Query: 64 MARGNQRDKAREANQKKMAEMKKSNSMSGSEMQREKEKVAAKMR 195 MARGNQR+KARE QK+MA+ KK N+MSG+E R KE AA MR Sbjct: 1 MARGNQREKAREKTQKEMAQQKKKNNMSGTEFARTKEAQAAIMR 44