BLASTX nr result
ID: Paeonia22_contig00046513
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00046513 (278 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007290432.1| 60S ribosomal protein L11 [Marssonina brunne... 69 7e-10 gb|EPE29239.1| Ribosomal protein L5 [Glarea lozoyensis ATCC 20868] 64 3e-08 ref|XP_001586298.1| 60S ribosomal protein L11 [Sclerotinia scler... 63 4e-08 gb|EPQ65884.1| Protein component of the large (60S) ribosomal su... 63 5e-08 ref|XP_001553621.1| 60S ribosomal protein L11 [Botryotinia fucke... 62 8e-08 gb|EMF09861.1| 60S ribosomal protein L11 [Sphaerulina musiva SO2... 62 1e-07 ref|XP_002148988.1| 60S ribosomal protein L11 [Talaromyces marne... 60 2e-07 gb|ESZ98896.1| 60S ribosomal protein L11 [Sclerotinia borealis F... 60 3e-07 ref|XP_002485190.1| 60S ribosomal protein L11 [Talaromyces stipi... 60 3e-07 gb|ERS98976.1| 60S ribosomal protein L11 [Sporothrix schenckii A... 60 4e-07 gb|EHK17585.1| hypothetical protein TRIVIDRAFT_76021 [Trichoderm... 58 1e-06 gb|ETS88104.1| 60S ribosomal protein L11 [Pestalotiopsis fici W1... 57 2e-06 ref|XP_003054198.1| 60S ribosomal protein L11 [Nectria haematoco... 57 2e-06 ref|XP_007593026.1| ribosomal L5P family protein [Colletotrichum... 57 3e-06 ref|XP_007586823.1| putative 60s ribosomal protein l11 protein [... 57 3e-06 gb|ENH88644.1| 60s ribosomal protein l11 [Colletotrichum orbicul... 57 3e-06 gb|ELR06252.1| 60S ribosomal protein L11 [Pseudogymnoascus destr... 57 3e-06 gb|ETN38315.1| 60S ribosomal protein L11 [Cyphellophora europaea... 56 5e-06 gb|EHL03348.1| putative 60S ribosomal protein L11 [Glarea lozoye... 56 5e-06 ref|XP_006671375.1| 60S ribosomal protein L11 [Cordyceps militar... 56 5e-06 >ref|XP_007290432.1| 60S ribosomal protein L11 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] gi|406866266|gb|EKD19306.1| 60S ribosomal protein L11 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] Length = 174 Score = 68.9 bits (167), Expect = 7e-10 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = +3 Query: 3 KRRRAKTHVGSAHKIKRDETVKWFKNRFEGIVR 101 KRRRAKT VGSAHKIKRDETVKWFKNRFEGIVR Sbjct: 142 KRRRAKTRVGSAHKIKRDETVKWFKNRFEGIVR 174 >gb|EPE29239.1| Ribosomal protein L5 [Glarea lozoyensis ATCC 20868] Length = 175 Score = 63.5 bits (153), Expect = 3e-08 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = +3 Query: 3 KRRRAKTHVGSAHKIKRDETVKWFKNRFEGIVR 101 KRRRAK+ VG++HKIKR+ETVKWFKNRFEGIVR Sbjct: 143 KRRRAKSRVGTSHKIKREETVKWFKNRFEGIVR 175 >ref|XP_001586298.1| 60S ribosomal protein L11 [Sclerotinia sclerotiorum 1980 UF-70] gi|154698281|gb|EDN98019.1| 60S ribosomal protein L11 [Sclerotinia sclerotiorum 1980 UF-70] Length = 175 Score = 63.2 bits (152), Expect = 4e-08 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = +3 Query: 3 KRRRAKTHVGSAHKIKRDETVKWFKNRFEGIVR 101 KRRR KT +G+ HKIKRDETVKWFKNRFEGIVR Sbjct: 143 KRRRCKTSIGANHKIKRDETVKWFKNRFEGIVR 175 >gb|EPQ65884.1| Protein component of the large (60S) ribosomal subunit [Blumeria graminis f. sp. tritici 96224] gi|528297384|emb|CCU76749.1| 60S ribosomal protein L11 [Blumeria graminis f. sp. hordei DH14] Length = 175 Score = 62.8 bits (151), Expect = 5e-08 Identities = 25/33 (75%), Positives = 32/33 (96%) Frame = +3 Query: 3 KRRRAKTHVGSAHKIKRDETVKWFKNRFEGIVR 101 KRRRA+TH+G+ H+IKR+E++KWFKNRFEGIVR Sbjct: 143 KRRRAQTHIGAGHRIKREESIKWFKNRFEGIVR 175 >ref|XP_001553621.1| 60S ribosomal protein L11 [Botryotinia fuckeliana B05.10] gi|347826642|emb|CCD42339.1| similar to 60s ribosomal protein l11 [Botryotinia fuckeliana T4] gi|472242744|gb|EMR87425.1| putative 60s ribosomal protein l11 protein [Botryotinia fuckeliana BcDW1] Length = 175 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = +3 Query: 3 KRRRAKTHVGSAHKIKRDETVKWFKNRFEGIVR 101 KRRR KT +G+ HKI+RDETVKWFKNRFEGIVR Sbjct: 143 KRRRCKTSIGANHKIRRDETVKWFKNRFEGIVR 175 >gb|EMF09861.1| 60S ribosomal protein L11 [Sphaerulina musiva SO2202] Length = 182 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = +3 Query: 3 KRRRAKTHVGSAHKIKRDETVKWFKNRFEGIVR 101 KRRR+KT +G++HKI RDETVKW+KNRFEGIVR Sbjct: 150 KRRRSKTRIGASHKIDRDETVKWYKNRFEGIVR 182 >ref|XP_002148988.1| 60S ribosomal protein L11 [Talaromyces marneffei ATCC 18224] gi|210068730|gb|EEA22821.1| 60S ribosomal protein L11 [Talaromyces marneffei ATCC 18224] Length = 175 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = +3 Query: 3 KRRRAKTHVGSAHKIKRDETVKWFKNRFEGIVR 101 KRRRAK H+GS HKI + ET+KWFKNRFEGIVR Sbjct: 143 KRRRAKAHIGSNHKITQGETIKWFKNRFEGIVR 175 >gb|ESZ98896.1| 60S ribosomal protein L11 [Sclerotinia borealis F-4157] Length = 175 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = +3 Query: 3 KRRRAKTHVGSAHKIKRDETVKWFKNRFEGIVR 101 KRRR K+ +G+ HKIKR+ETVKWFKNRFEGIVR Sbjct: 143 KRRRCKSSIGANHKIKREETVKWFKNRFEGIVR 175 >ref|XP_002485190.1| 60S ribosomal protein L11 [Talaromyces stipitatus ATCC 10500] gi|218715815|gb|EED15237.1| 60S ribosomal protein L11 [Talaromyces stipitatus ATCC 10500] Length = 175 Score = 60.1 bits (144), Expect = 3e-07 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = +3 Query: 3 KRRRAKTHVGSAHKIKRDETVKWFKNRFEGIVR 101 KRRRAK H+GS+H+I + ET+KWFKNRFEGIVR Sbjct: 143 KRRRAKAHIGSSHRITQAETIKWFKNRFEGIVR 175 >gb|ERS98976.1| 60S ribosomal protein L11 [Sporothrix schenckii ATCC 58251] Length = 179 Score = 59.7 bits (143), Expect = 4e-07 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = +3 Query: 3 KRRRAKTHVGSAHKIKRDETVKWFKNRFEGIVR 101 +RRRAK VGS+HKI RDETVKWFK+RF+GIVR Sbjct: 147 RRRRAKARVGSSHKINRDETVKWFKSRFDGIVR 179 >gb|EHK17585.1| hypothetical protein TRIVIDRAFT_76021 [Trichoderma virens Gv29-8] Length = 173 Score = 58.2 bits (139), Expect = 1e-06 Identities = 24/33 (72%), Positives = 30/33 (90%) Frame = +3 Query: 3 KRRRAKTHVGSAHKIKRDETVKWFKNRFEGIVR 101 +RRR K+ +GS+H+IKRDETVKWFK RF+GIVR Sbjct: 141 RRRRMKSRIGSSHRIKRDETVKWFKGRFDGIVR 173 >gb|ETS88104.1| 60S ribosomal protein L11 [Pestalotiopsis fici W106-1] Length = 173 Score = 57.4 bits (137), Expect = 2e-06 Identities = 24/33 (72%), Positives = 30/33 (90%) Frame = +3 Query: 3 KRRRAKTHVGSAHKIKRDETVKWFKNRFEGIVR 101 +RRRAK +G++HKI RDETVKWFK+RF+GIVR Sbjct: 141 RRRRAKGRIGASHKINRDETVKWFKSRFDGIVR 173 >ref|XP_003054198.1| 60S ribosomal protein L11 [Nectria haematococca mpVI 77-13-4] gi|256735139|gb|EEU48485.1| predicted protein [Nectria haematococca mpVI 77-13-4] Length = 173 Score = 57.4 bits (137), Expect = 2e-06 Identities = 23/33 (69%), Positives = 30/33 (90%) Frame = +3 Query: 3 KRRRAKTHVGSAHKIKRDETVKWFKNRFEGIVR 101 +RRR K+ +G+ H+IKRDETVKWFK+RF+GIVR Sbjct: 141 RRRRTKSRIGAGHRIKRDETVKWFKSRFDGIVR 173 >ref|XP_007593026.1| ribosomal L5P family protein [Colletotrichum fioriniae PJ7] gi|588903161|gb|EXF83340.1| ribosomal L5P family protein [Colletotrichum fioriniae PJ7] Length = 173 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = +3 Query: 6 RRRAKTHVGSAHKIKRDETVKWFKNRFEGIVR 101 RRR K +GS H+IKRDETVKWFK+RF+GIVR Sbjct: 142 RRRCKGRIGSGHRIKRDETVKWFKSRFDGIVR 173 >ref|XP_007586823.1| putative 60s ribosomal protein l11 protein [Neofusicoccum parvum UCRNP2] gi|485919342|gb|EOD45707.1| putative 60s ribosomal protein l11 protein [Neofusicoccum parvum UCRNP2] Length = 191 Score = 56.6 bits (135), Expect = 3e-06 Identities = 23/33 (69%), Positives = 30/33 (90%) Frame = +3 Query: 3 KRRRAKTHVGSAHKIKRDETVKWFKNRFEGIVR 101 KRRR+K +GS+HKI ++ET+KW+KNRFEGIVR Sbjct: 159 KRRRSKNKIGSSHKITQNETIKWYKNRFEGIVR 191 >gb|ENH88644.1| 60s ribosomal protein l11 [Colletotrichum orbiculare MAFF 240422] Length = 172 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = +3 Query: 6 RRRAKTHVGSAHKIKRDETVKWFKNRFEGIVR 101 RRR K+ +GS HKIKR+ETVKWFK+RF+GIVR Sbjct: 141 RRRCKSRIGSNHKIKREETVKWFKSRFDGIVR 172 >gb|ELR06252.1| 60S ribosomal protein L11 [Pseudogymnoascus destructans 20631-21] Length = 172 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/33 (72%), Positives = 30/33 (90%) Frame = +3 Query: 3 KRRRAKTHVGSAHKIKRDETVKWFKNRFEGIVR 101 KRRRA+T VG++HKI++DE VKW+K RFEGIVR Sbjct: 140 KRRRARTAVGASHKIRKDEIVKWYKQRFEGIVR 172 >gb|ETN38315.1| 60S ribosomal protein L11 [Cyphellophora europaea CBS 101466] Length = 175 Score = 56.2 bits (134), Expect = 5e-06 Identities = 23/33 (69%), Positives = 29/33 (87%) Frame = +3 Query: 3 KRRRAKTHVGSAHKIKRDETVKWFKNRFEGIVR 101 +RRR K VG +HK++RD++VKWFKNRFEGIVR Sbjct: 143 RRRRTKAAVGRSHKVRRDDSVKWFKNRFEGIVR 175 >gb|EHL03348.1| putative 60S ribosomal protein L11 [Glarea lozoyensis 74030] Length = 172 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/29 (82%), Positives = 28/29 (96%) Frame = +3 Query: 3 KRRRAKTHVGSAHKIKRDETVKWFKNRFE 89 KRRRAK+ VG++HKIKR+ETVKWFKNRFE Sbjct: 143 KRRRAKSRVGTSHKIKREETVKWFKNRFE 171 >ref|XP_006671375.1| 60S ribosomal protein L11 [Cordyceps militaris CM01] gi|346322412|gb|EGX92011.1| 60S ribosomal protein L11 [Cordyceps militaris CM01] Length = 173 Score = 56.2 bits (134), Expect = 5e-06 Identities = 23/33 (69%), Positives = 30/33 (90%) Frame = +3 Query: 3 KRRRAKTHVGSAHKIKRDETVKWFKNRFEGIVR 101 +RRR K+ +GS+H+IKRDETV+WFK RF+GIVR Sbjct: 141 RRRRMKSTIGSSHRIKRDETVRWFKTRFDGIVR 173