BLASTX nr result
ID: Paeonia22_contig00046483
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00046483 (231 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004228991.1| PREDICTED: uncharacterized protein LOC101254... 62 6e-08 ref|XP_004228336.1| PREDICTED: membrane-bound transcription fact... 62 6e-08 ref|XP_006358738.1| PREDICTED: membrane-bound transcription fact... 59 9e-07 ref|XP_002532703.1| protease m50 membrane-bound transcription fa... 59 9e-07 gb|EYU43610.1| hypothetical protein MIMGU_mgv1a005741mg [Mimulus... 57 2e-06 gb|EYU38181.1| hypothetical protein MIMGU_mgv1a026360mg, partial... 57 2e-06 ref|XP_004160386.1| PREDICTED: uncharacterized protein LOC101231... 57 3e-06 ref|XP_004145951.1| PREDICTED: membrane-bound transcription fact... 57 3e-06 gb|EXB56438.1| Membrane-bound transcription factor site-2 protea... 55 8e-06 >ref|XP_004228991.1| PREDICTED: uncharacterized protein LOC101254828 [Solanum lycopersicum] Length = 528 Score = 62.4 bits (150), Expect = 6e-08 Identities = 28/54 (51%), Positives = 37/54 (68%), Gaps = 5/54 (9%) Frame = +2 Query: 83 MQGRRARR-----QNQPLLPLRTRRIPNTISFWYCDFKITAFNQPLFRFGQRHA 229 M+GRR RR NQ LLP+R R+ N +S WYCD K + N+PLFRFG+R++ Sbjct: 1 MEGRRVRRFGRWRSNQTLLPVRVNRLSNAVSCWYCDCKSSILNEPLFRFGRRYS 54 >ref|XP_004228336.1| PREDICTED: membrane-bound transcription factor site-2 protease-like [Solanum lycopersicum] Length = 534 Score = 62.4 bits (150), Expect = 6e-08 Identities = 28/54 (51%), Positives = 37/54 (68%), Gaps = 5/54 (9%) Frame = +2 Query: 83 MQGRRARR-----QNQPLLPLRTRRIPNTISFWYCDFKITAFNQPLFRFGQRHA 229 M+GRR RR NQ LLP+R R+ N +S WYCD K + N+PLFRFG+R++ Sbjct: 1 MEGRRVRRFGRWRSNQTLLPVRVNRLSNAVSCWYCDCKSSILNEPLFRFGRRYS 54 >ref|XP_006358738.1| PREDICTED: membrane-bound transcription factor site-2 protease-like [Solanum tuberosum] Length = 588 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/54 (48%), Positives = 36/54 (66%), Gaps = 5/54 (9%) Frame = +2 Query: 83 MQGRRARR-----QNQPLLPLRTRRIPNTISFWYCDFKITAFNQPLFRFGQRHA 229 M+GRR RR NQ LLP+R R+ N +S WYCD K + N+PLF FG++++ Sbjct: 1 MEGRRVRRFGRWRSNQTLLPVRVNRLSNAVSCWYCDCKSSILNEPLFGFGRKYS 54 >ref|XP_002532703.1| protease m50 membrane-bound transcription factor site 2 protease, putative [Ricinus communis] gi|223527549|gb|EEF29670.1| protease m50 membrane-bound transcription factor site 2 protease, putative [Ricinus communis] Length = 537 Score = 58.5 bits (140), Expect = 9e-07 Identities = 29/51 (56%), Positives = 34/51 (66%), Gaps = 5/51 (9%) Frame = +2 Query: 92 RRARRQNQPLLPLRTR-----RIPNTISFWYCDFKITAFNQPLFRFGQRHA 229 R R Q LLPL+T R+ NTIS W+CD+KITAFN LFR G+RHA Sbjct: 9 RFGRAQRHRLLPLQTSETGIPRLSNTISCWFCDYKITAFNSQLFRIGRRHA 59 >gb|EYU43610.1| hypothetical protein MIMGU_mgv1a005741mg [Mimulus guttatus] Length = 472 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/50 (54%), Positives = 36/50 (72%), Gaps = 3/50 (6%) Frame = +2 Query: 89 GRRA--RRQNQPLLPLRT-RRIPNTISFWYCDFKITAFNQPLFRFGQRHA 229 GRR R +Q LLP+R ++ T+S WYCDFK +A N+PLFRFG+RH+ Sbjct: 6 GRRGEIRWSDQTLLPMRPIKQFSGTVSCWYCDFKFSALNEPLFRFGRRHS 55 >gb|EYU38181.1| hypothetical protein MIMGU_mgv1a026360mg, partial [Mimulus guttatus] Length = 419 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/50 (56%), Positives = 36/50 (72%), Gaps = 3/50 (6%) Frame = +2 Query: 89 GRRA--RRQNQPLLPLRT-RRIPNTISFWYCDFKITAFNQPLFRFGQRHA 229 GRR R +Q LLPLR ++ T+S WYCDFK +A N+PLFRFG+RH+ Sbjct: 6 GRRGEIRWGDQTLLPLRRIKQFSGTVSCWYCDFKFSALNEPLFRFGRRHS 55 >ref|XP_004160386.1| PREDICTED: uncharacterized protein LOC101231165 [Cucumis sativus] Length = 99 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/40 (62%), Positives = 33/40 (82%), Gaps = 2/40 (5%) Frame = +2 Query: 116 PLLPLRTRR--IPNTISFWYCDFKITAFNQPLFRFGQRHA 229 PLLPL T R + N+IS WYCD+KIT+FN+ +F+FG+RHA Sbjct: 23 PLLPLTTSRKGLSNSISCWYCDYKITSFNELIFQFGRRHA 62 >ref|XP_004145951.1| PREDICTED: membrane-bound transcription factor site-2 protease-like [Cucumis sativus] Length = 541 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/40 (62%), Positives = 33/40 (82%), Gaps = 2/40 (5%) Frame = +2 Query: 116 PLLPLRTRR--IPNTISFWYCDFKITAFNQPLFRFGQRHA 229 PLLPL T R + N+IS WYCD+KIT+FN+ +F+FG+RHA Sbjct: 23 PLLPLTTSRKGLSNSISCWYCDYKITSFNELIFQFGRRHA 62 >gb|EXB56438.1| Membrane-bound transcription factor site-2 protease [Morus notabilis] Length = 549 Score = 55.5 bits (132), Expect = 8e-06 Identities = 31/63 (49%), Positives = 38/63 (60%), Gaps = 15/63 (23%) Frame = +2 Query: 86 QGRRARR--------QNQPLLPLRTRRIP-----NTISF--WYCDFKITAFNQPLFRFGQ 220 +GRR RR N LLPLR+R P N+ISF WYCD+KI+ NQPLF G+ Sbjct: 4 EGRRVRRFGSEREFRTNHSLLPLRSRTTPPPSLSNSISFSCWYCDYKISTLNQPLFHLGR 63 Query: 221 RHA 229 R+A Sbjct: 64 RYA 66