BLASTX nr result
ID: Paeonia22_contig00046439
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00046439 (302 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB75214.1| putative LRR receptor-like serine/threonine-prote... 68 2e-09 emb|CBI31028.3| unnamed protein product [Vitis vinifera] 67 2e-09 ref|XP_002264110.1| PREDICTED: probable LRR receptor-like serine... 67 2e-09 ref|XP_002264039.1| PREDICTED: probable LRR receptor-like serine... 67 2e-09 ref|XP_002523183.1| protein binding protein, putative [Ricinus c... 67 3e-09 ref|XP_006468323.1| PREDICTED: probable LRR receptor-like serine... 66 4e-09 ref|XP_006448883.1| hypothetical protein CICLE_v10014111mg [Citr... 66 4e-09 ref|XP_002300567.2| leucine-rich repeat family protein [Populus ... 65 8e-09 ref|XP_004486464.1| PREDICTED: probable LRR receptor-like serine... 65 8e-09 ref|XP_003594540.1| hypothetical protein MTR_2g030380 [Medicago ... 65 8e-09 ref|XP_007147475.1| hypothetical protein PHAVU_006G127700g [Phas... 65 1e-08 ref|XP_004293981.1| PREDICTED: probable LRR receptor-like serine... 65 1e-08 ref|XP_007213699.1| hypothetical protein PRUPE_ppa000762mg [Prun... 65 1e-08 ref|XP_003535094.1| PREDICTED: probable LRR receptor-like serine... 65 1e-08 gb|AGT59499.1| GHR1 protein [Arabidopsis thaliana] 65 1e-08 ref|XP_006283044.1| hypothetical protein CARUB_v10004041mg [Caps... 65 1e-08 ref|NP_193826.2| leucine-rich receptor-like protein kinase [Arab... 65 1e-08 ref|XP_002869920.1| leucine-rich repeat family protein [Arabidop... 65 1e-08 sp|C0LGQ9.1|Y4294_ARATH RecName: Full=Probable LRR receptor-like... 65 1e-08 ref|XP_006413948.1| hypothetical protein EUTSA_v10024290mg [Eutr... 64 2e-08 >gb|EXB75214.1| putative LRR receptor-like serine/threonine-protein kinase [Morus notabilis] Length = 1045 Score = 67.8 bits (164), Expect = 2e-09 Identities = 34/37 (91%), Positives = 35/37 (94%) Frame = +1 Query: 1 PAVEKGVKAVLEIALRCIRSVSERPGIKTIYEDLSSI 111 PAVEKG+K VL IALRCIRSVSERPGIKTIYEDLSSI Sbjct: 1009 PAVEKGMKEVLGIALRCIRSVSERPGIKTIYEDLSSI 1045 >emb|CBI31028.3| unnamed protein product [Vitis vinifera] Length = 908 Score = 67.4 bits (163), Expect = 2e-09 Identities = 34/37 (91%), Positives = 34/37 (91%) Frame = +1 Query: 1 PAVEKGVKAVLEIALRCIRSVSERPGIKTIYEDLSSI 111 PA EKGVK VL IALRCIRSVSERPGIKTIYEDLSSI Sbjct: 872 PAAEKGVKEVLGIALRCIRSVSERPGIKTIYEDLSSI 908 >ref|XP_002264110.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At4g20940-like isoform 2 [Vitis vinifera] Length = 987 Score = 67.4 bits (163), Expect = 2e-09 Identities = 34/37 (91%), Positives = 34/37 (91%) Frame = +1 Query: 1 PAVEKGVKAVLEIALRCIRSVSERPGIKTIYEDLSSI 111 PA EKGVK VL IALRCIRSVSERPGIKTIYEDLSSI Sbjct: 951 PAAEKGVKEVLGIALRCIRSVSERPGIKTIYEDLSSI 987 >ref|XP_002264039.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At4g20940-like isoform 1 [Vitis vinifera] Length = 1064 Score = 67.4 bits (163), Expect = 2e-09 Identities = 34/37 (91%), Positives = 34/37 (91%) Frame = +1 Query: 1 PAVEKGVKAVLEIALRCIRSVSERPGIKTIYEDLSSI 111 PA EKGVK VL IALRCIRSVSERPGIKTIYEDLSSI Sbjct: 1028 PAAEKGVKEVLGIALRCIRSVSERPGIKTIYEDLSSI 1064 >ref|XP_002523183.1| protein binding protein, putative [Ricinus communis] gi|223537590|gb|EEF39214.1| protein binding protein, putative [Ricinus communis] Length = 1060 Score = 66.6 bits (161), Expect = 3e-09 Identities = 33/37 (89%), Positives = 34/37 (91%) Frame = +1 Query: 1 PAVEKGVKAVLEIALRCIRSVSERPGIKTIYEDLSSI 111 PAVEKG K VL +ALRCIRSVSERPGIKTIYEDLSSI Sbjct: 1024 PAVEKGTKEVLGLALRCIRSVSERPGIKTIYEDLSSI 1060 >ref|XP_006468323.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At4g20940-like [Citrus sinensis] Length = 1060 Score = 66.2 bits (160), Expect = 4e-09 Identities = 33/37 (89%), Positives = 34/37 (91%) Frame = +1 Query: 1 PAVEKGVKAVLEIALRCIRSVSERPGIKTIYEDLSSI 111 PA EKG+K VL IALRCIRSVSERPGIKTIYEDLSSI Sbjct: 1024 PAAEKGMKEVLGIALRCIRSVSERPGIKTIYEDLSSI 1060 >ref|XP_006448883.1| hypothetical protein CICLE_v10014111mg [Citrus clementina] gi|557551494|gb|ESR62123.1| hypothetical protein CICLE_v10014111mg [Citrus clementina] Length = 1060 Score = 66.2 bits (160), Expect = 4e-09 Identities = 33/37 (89%), Positives = 34/37 (91%) Frame = +1 Query: 1 PAVEKGVKAVLEIALRCIRSVSERPGIKTIYEDLSSI 111 PA EKG+K VL IALRCIRSVSERPGIKTIYEDLSSI Sbjct: 1024 PAAEKGMKEVLGIALRCIRSVSERPGIKTIYEDLSSI 1060 >ref|XP_002300567.2| leucine-rich repeat family protein [Populus trichocarpa] gi|550350055|gb|EEE85372.2| leucine-rich repeat family protein [Populus trichocarpa] Length = 1008 Score = 65.5 bits (158), Expect = 8e-09 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = +1 Query: 1 PAVEKGVKAVLEIALRCIRSVSERPGIKTIYEDLSSI 111 PAV+KG+K VL IALRCIRSVS+RPGIKTIYEDLSSI Sbjct: 972 PAVDKGMKEVLGIALRCIRSVSDRPGIKTIYEDLSSI 1008 >ref|XP_004486464.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At4g20940-like isoform X1 [Cicer arietinum] gi|502080124|ref|XP_004486465.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At4g20940-like isoform X2 [Cicer arietinum] Length = 1063 Score = 65.5 bits (158), Expect = 8e-09 Identities = 32/37 (86%), Positives = 34/37 (91%) Frame = +1 Query: 1 PAVEKGVKAVLEIALRCIRSVSERPGIKTIYEDLSSI 111 P VEKG+K VL IA+RCIRSVSERPGIKTIYEDLSSI Sbjct: 1027 PVVEKGMKEVLGIAIRCIRSVSERPGIKTIYEDLSSI 1063 >ref|XP_003594540.1| hypothetical protein MTR_2g030380 [Medicago truncatula] gi|355483588|gb|AES64791.1| hypothetical protein MTR_2g030380 [Medicago truncatula] Length = 1048 Score = 65.5 bits (158), Expect = 8e-09 Identities = 32/37 (86%), Positives = 34/37 (91%) Frame = +1 Query: 1 PAVEKGVKAVLEIALRCIRSVSERPGIKTIYEDLSSI 111 P VEKG+K VL IA+RCIRSVSERPGIKTIYEDLSSI Sbjct: 1012 PVVEKGMKEVLGIAIRCIRSVSERPGIKTIYEDLSSI 1048 >ref|XP_007147475.1| hypothetical protein PHAVU_006G127700g [Phaseolus vulgaris] gi|593693910|ref|XP_007147476.1| hypothetical protein PHAVU_006G127700g [Phaseolus vulgaris] gi|561020698|gb|ESW19469.1| hypothetical protein PHAVU_006G127700g [Phaseolus vulgaris] gi|561020699|gb|ESW19470.1| hypothetical protein PHAVU_006G127700g [Phaseolus vulgaris] Length = 1061 Score = 65.1 bits (157), Expect = 1e-08 Identities = 32/37 (86%), Positives = 34/37 (91%) Frame = +1 Query: 1 PAVEKGVKAVLEIALRCIRSVSERPGIKTIYEDLSSI 111 P VEKG+K VL IA+RCIRSVSERPGIKTIYEDLSSI Sbjct: 1025 PIVEKGMKEVLGIAMRCIRSVSERPGIKTIYEDLSSI 1061 >ref|XP_004293981.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At4g20940-like [Fragaria vesca subsp. vesca] Length = 1065 Score = 65.1 bits (157), Expect = 1e-08 Identities = 32/37 (86%), Positives = 34/37 (91%) Frame = +1 Query: 1 PAVEKGVKAVLEIALRCIRSVSERPGIKTIYEDLSSI 111 PA EKG+K VL I+LRCIRSVSERPGIKTIYEDLSSI Sbjct: 1029 PAAEKGMKEVLGISLRCIRSVSERPGIKTIYEDLSSI 1065 >ref|XP_007213699.1| hypothetical protein PRUPE_ppa000762mg [Prunus persica] gi|462409564|gb|EMJ14898.1| hypothetical protein PRUPE_ppa000762mg [Prunus persica] Length = 1012 Score = 65.1 bits (157), Expect = 1e-08 Identities = 32/37 (86%), Positives = 34/37 (91%) Frame = +1 Query: 1 PAVEKGVKAVLEIALRCIRSVSERPGIKTIYEDLSSI 111 PA EKG+K VL I+LRCIRSVSERPGIKTIYEDLSSI Sbjct: 976 PAAEKGMKEVLGISLRCIRSVSERPGIKTIYEDLSSI 1012 >ref|XP_003535094.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At4g20940-like isoform X1 [Glycine max] gi|571476033|ref|XP_006586842.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At4g20940-like isoform X2 [Glycine max] Length = 1062 Score = 65.1 bits (157), Expect = 1e-08 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = +1 Query: 1 PAVEKGVKAVLEIALRCIRSVSERPGIKTIYEDLSSI 111 P VEKG+K VL IA+RCIRS+SERPGIKTIYEDLSSI Sbjct: 1026 PVVEKGMKEVLGIAMRCIRSISERPGIKTIYEDLSSI 1062 >gb|AGT59499.1| GHR1 protein [Arabidopsis thaliana] Length = 1053 Score = 64.7 bits (156), Expect = 1e-08 Identities = 32/37 (86%), Positives = 33/37 (89%) Frame = +1 Query: 1 PAVEKGVKAVLEIALRCIRSVSERPGIKTIYEDLSSI 111 P EKG+K VL IALRCIRSVSERPGIKTIYEDLSSI Sbjct: 1017 PVTEKGMKEVLGIALRCIRSVSERPGIKTIYEDLSSI 1053 >ref|XP_006283044.1| hypothetical protein CARUB_v10004041mg [Capsella rubella] gi|482551749|gb|EOA15942.1| hypothetical protein CARUB_v10004041mg [Capsella rubella] Length = 1052 Score = 64.7 bits (156), Expect = 1e-08 Identities = 32/37 (86%), Positives = 33/37 (89%) Frame = +1 Query: 1 PAVEKGVKAVLEIALRCIRSVSERPGIKTIYEDLSSI 111 P EKG+K VL IALRCIRSVSERPGIKTIYEDLSSI Sbjct: 1016 PVTEKGMKEVLGIALRCIRSVSERPGIKTIYEDLSSI 1052 >ref|NP_193826.2| leucine-rich receptor-like protein kinase [Arabidopsis thaliana] gi|332658978|gb|AEE84378.1| leucine-rich receptor-like protein kinase [Arabidopsis thaliana] Length = 977 Score = 64.7 bits (156), Expect = 1e-08 Identities = 32/37 (86%), Positives = 33/37 (89%) Frame = +1 Query: 1 PAVEKGVKAVLEIALRCIRSVSERPGIKTIYEDLSSI 111 P EKG+K VL IALRCIRSVSERPGIKTIYEDLSSI Sbjct: 941 PVTEKGMKEVLGIALRCIRSVSERPGIKTIYEDLSSI 977 >ref|XP_002869920.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. lyrata] gi|297315756|gb|EFH46179.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. lyrata] Length = 977 Score = 64.7 bits (156), Expect = 1e-08 Identities = 32/37 (86%), Positives = 33/37 (89%) Frame = +1 Query: 1 PAVEKGVKAVLEIALRCIRSVSERPGIKTIYEDLSSI 111 P EKG+K VL IALRCIRSVSERPGIKTIYEDLSSI Sbjct: 941 PVTEKGMKEVLGIALRCIRSVSERPGIKTIYEDLSSI 977 >sp|C0LGQ9.1|Y4294_ARATH RecName: Full=Probable LRR receptor-like serine/threonine-protein kinase At4g20940 gi|224589622|gb|ACN59344.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis thaliana] Length = 1037 Score = 64.7 bits (156), Expect = 1e-08 Identities = 32/37 (86%), Positives = 33/37 (89%) Frame = +1 Query: 1 PAVEKGVKAVLEIALRCIRSVSERPGIKTIYEDLSSI 111 P EKG+K VL IALRCIRSVSERPGIKTIYEDLSSI Sbjct: 1001 PVTEKGMKEVLGIALRCIRSVSERPGIKTIYEDLSSI 1037 >ref|XP_006413948.1| hypothetical protein EUTSA_v10024290mg [Eutrema salsugineum] gi|557115118|gb|ESQ55401.1| hypothetical protein EUTSA_v10024290mg [Eutrema salsugineum] Length = 1054 Score = 64.3 bits (155), Expect = 2e-08 Identities = 32/37 (86%), Positives = 32/37 (86%) Frame = +1 Query: 1 PAVEKGVKAVLEIALRCIRSVSERPGIKTIYEDLSSI 111 P EKG K VL IALRCIRSVSERPGIKTIYEDLSSI Sbjct: 1018 PVTEKGTKEVLGIALRCIRSVSERPGIKTIYEDLSSI 1054