BLASTX nr result
ID: Paeonia22_contig00046432
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00046432 (330 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC06152.1| ELMO domain-containing protein A [Morus notabilis] 85 9e-15 ref|XP_007044045.1| ELMO/CED-12 domain-containing protein isofor... 85 9e-15 ref|XP_007044044.1| ELMO/CED-12 domain-containing protein isofor... 85 9e-15 ref|XP_007044043.1| ELMO/CED-12 family protein isoform 2 [Theobr... 85 9e-15 ref|XP_007044042.1| ELMO/CED-12 domain-containing protein isofor... 85 9e-15 ref|XP_004310072.1| PREDICTED: ELMO domain-containing protein A-... 85 9e-15 emb|CBI27646.3| unnamed protein product [Vitis vinifera] 85 9e-15 ref|XP_002271815.1| PREDICTED: ELMO domain-containing protein A-... 85 9e-15 ref|XP_006379928.1| hypothetical protein POPTR_0008s17540g [Popu... 84 3e-14 ref|XP_002312624.2| phagocytosis and cell motility protein ELMO1... 84 3e-14 ref|XP_007227163.1| hypothetical protein PRUPE_ppa025471mg, part... 84 3e-14 ref|XP_004135318.1| PREDICTED: ELMO domain-containing protein A-... 82 6e-14 ref|XP_006484090.1| PREDICTED: ELMO domain-containing protein A-... 82 8e-14 ref|XP_006484089.1| PREDICTED: ELMO domain-containing protein A-... 82 8e-14 ref|XP_006438044.1| hypothetical protein CICLE_v10032373mg [Citr... 82 8e-14 ref|XP_006438042.1| hypothetical protein CICLE_v10032373mg [Citr... 82 8e-14 ref|XP_006438041.1| hypothetical protein CICLE_v10032373mg [Citr... 82 8e-14 ref|XP_002514926.1| ELMO domain-containing protein, putative [Ri... 82 8e-14 ref|XP_002315612.2| hypothetical protein POPTR_0010s07040g [Popu... 80 3e-13 ref|XP_006601899.1| PREDICTED: ELMO domain-containing protein A-... 80 4e-13 >gb|EXC06152.1| ELMO domain-containing protein A [Morus notabilis] Length = 306 Score = 85.1 bits (209), Expect = 9e-15 Identities = 40/45 (88%), Positives = 44/45 (97%) Frame = -2 Query: 329 KQWLERNASYMEFNDVLKSTRAQLERELIMDNVLRIEDMPSFGLL 195 KQWLERNA+YMEFNDVLKSTRAQLEREL+MD+VLRIEDMPS+ LL Sbjct: 261 KQWLERNATYMEFNDVLKSTRAQLERELLMDDVLRIEDMPSYSLL 305 >ref|XP_007044045.1| ELMO/CED-12 domain-containing protein isoform 4 [Theobroma cacao] gi|508707980|gb|EOX99876.1| ELMO/CED-12 domain-containing protein isoform 4 [Theobroma cacao] Length = 270 Score = 85.1 bits (209), Expect = 9e-15 Identities = 40/45 (88%), Positives = 44/45 (97%) Frame = -2 Query: 329 KQWLERNASYMEFNDVLKSTRAQLERELIMDNVLRIEDMPSFGLL 195 KQWLERNA+YMEFNDVLKSTRAQLEREL+MD+VLRIEDMPS+ LL Sbjct: 225 KQWLERNATYMEFNDVLKSTRAQLERELLMDDVLRIEDMPSYSLL 269 >ref|XP_007044044.1| ELMO/CED-12 domain-containing protein isoform 3 [Theobroma cacao] gi|508707979|gb|EOX99875.1| ELMO/CED-12 domain-containing protein isoform 3 [Theobroma cacao] Length = 269 Score = 85.1 bits (209), Expect = 9e-15 Identities = 40/45 (88%), Positives = 44/45 (97%) Frame = -2 Query: 329 KQWLERNASYMEFNDVLKSTRAQLERELIMDNVLRIEDMPSFGLL 195 KQWLERNA+YMEFNDVLKSTRAQLEREL+MD+VLRIEDMPS+ LL Sbjct: 224 KQWLERNATYMEFNDVLKSTRAQLERELLMDDVLRIEDMPSYSLL 268 >ref|XP_007044043.1| ELMO/CED-12 family protein isoform 2 [Theobroma cacao] gi|508707978|gb|EOX99874.1| ELMO/CED-12 family protein isoform 2 [Theobroma cacao] Length = 269 Score = 85.1 bits (209), Expect = 9e-15 Identities = 40/45 (88%), Positives = 44/45 (97%) Frame = -2 Query: 329 KQWLERNASYMEFNDVLKSTRAQLERELIMDNVLRIEDMPSFGLL 195 KQWLERNA+YMEFNDVLKSTRAQLEREL+MD+VLRIEDMPS+ LL Sbjct: 224 KQWLERNATYMEFNDVLKSTRAQLERELLMDDVLRIEDMPSYSLL 268 >ref|XP_007044042.1| ELMO/CED-12 domain-containing protein isoform 1 [Theobroma cacao] gi|508707977|gb|EOX99873.1| ELMO/CED-12 domain-containing protein isoform 1 [Theobroma cacao] Length = 326 Score = 85.1 bits (209), Expect = 9e-15 Identities = 40/45 (88%), Positives = 44/45 (97%) Frame = -2 Query: 329 KQWLERNASYMEFNDVLKSTRAQLERELIMDNVLRIEDMPSFGLL 195 KQWLERNA+YMEFNDVLKSTRAQLEREL+MD+VLRIEDMPS+ LL Sbjct: 281 KQWLERNATYMEFNDVLKSTRAQLERELLMDDVLRIEDMPSYSLL 325 >ref|XP_004310072.1| PREDICTED: ELMO domain-containing protein A-like [Fragaria vesca subsp. vesca] Length = 261 Score = 85.1 bits (209), Expect = 9e-15 Identities = 40/45 (88%), Positives = 44/45 (97%) Frame = -2 Query: 329 KQWLERNASYMEFNDVLKSTRAQLERELIMDNVLRIEDMPSFGLL 195 KQWLERNA+YMEFNDVLKSTRAQLEREL+MD+VLRIEDMPS+ LL Sbjct: 216 KQWLERNATYMEFNDVLKSTRAQLERELLMDDVLRIEDMPSYSLL 260 >emb|CBI27646.3| unnamed protein product [Vitis vinifera] Length = 269 Score = 85.1 bits (209), Expect = 9e-15 Identities = 39/45 (86%), Positives = 45/45 (100%) Frame = -2 Query: 329 KQWLERNASYMEFNDVLKSTRAQLERELIMDNVLRIEDMPSFGLL 195 KQWL+RNA+YMEFNDVLKSTRAQLE+EL+MD+VLRIEDMPS+GLL Sbjct: 224 KQWLDRNATYMEFNDVLKSTRAQLEKELLMDDVLRIEDMPSYGLL 268 >ref|XP_002271815.1| PREDICTED: ELMO domain-containing protein A-like [Vitis vinifera] Length = 301 Score = 85.1 bits (209), Expect = 9e-15 Identities = 39/45 (86%), Positives = 45/45 (100%) Frame = -2 Query: 329 KQWLERNASYMEFNDVLKSTRAQLERELIMDNVLRIEDMPSFGLL 195 KQWL+RNA+YMEFNDVLKSTRAQLE+EL+MD+VLRIEDMPS+GLL Sbjct: 256 KQWLDRNATYMEFNDVLKSTRAQLEKELLMDDVLRIEDMPSYGLL 300 >ref|XP_006379928.1| hypothetical protein POPTR_0008s17540g [Populus trichocarpa] gi|550333305|gb|ERP57725.1| hypothetical protein POPTR_0008s17540g [Populus trichocarpa] Length = 191 Score = 83.6 bits (205), Expect = 3e-14 Identities = 38/45 (84%), Positives = 44/45 (97%) Frame = -2 Query: 329 KQWLERNASYMEFNDVLKSTRAQLERELIMDNVLRIEDMPSFGLL 195 KQWLERNA+YMEFND+LKSTRAQ+EREL+MD+VLRIEDMPS+ LL Sbjct: 146 KQWLERNATYMEFNDILKSTRAQVERELLMDDVLRIEDMPSYSLL 190 >ref|XP_002312624.2| phagocytosis and cell motility protein ELMO1 [Populus trichocarpa] gi|550333304|gb|EEE89991.2| phagocytosis and cell motility protein ELMO1 [Populus trichocarpa] Length = 207 Score = 83.6 bits (205), Expect = 3e-14 Identities = 38/45 (84%), Positives = 44/45 (97%) Frame = -2 Query: 329 KQWLERNASYMEFNDVLKSTRAQLERELIMDNVLRIEDMPSFGLL 195 KQWLERNA+YMEFND+LKSTRAQ+EREL+MD+VLRIEDMPS+ LL Sbjct: 162 KQWLERNATYMEFNDILKSTRAQVERELLMDDVLRIEDMPSYSLL 206 >ref|XP_007227163.1| hypothetical protein PRUPE_ppa025471mg, partial [Prunus persica] gi|462424099|gb|EMJ28362.1| hypothetical protein PRUPE_ppa025471mg, partial [Prunus persica] Length = 224 Score = 83.6 bits (205), Expect = 3e-14 Identities = 39/45 (86%), Positives = 43/45 (95%) Frame = -2 Query: 329 KQWLERNASYMEFNDVLKSTRAQLERELIMDNVLRIEDMPSFGLL 195 KQWLERNA+YMEFNDVLKSTRAQLEREL+MD+V RIEDMPS+ LL Sbjct: 179 KQWLERNATYMEFNDVLKSTRAQLERELLMDDVFRIEDMPSYSLL 223 >ref|XP_004135318.1| PREDICTED: ELMO domain-containing protein A-like [Cucumis sativus] gi|449494913|ref|XP_004159681.1| PREDICTED: ELMO domain-containing protein A-like [Cucumis sativus] Length = 276 Score = 82.4 bits (202), Expect = 6e-14 Identities = 38/45 (84%), Positives = 44/45 (97%) Frame = -2 Query: 329 KQWLERNASYMEFNDVLKSTRAQLERELIMDNVLRIEDMPSFGLL 195 KQWLERNA+YMEFNDVLKSTRAQLE+EL+M++VLRIEDMPS+ LL Sbjct: 226 KQWLERNATYMEFNDVLKSTRAQLEKELLMEDVLRIEDMPSYNLL 270 >ref|XP_006484090.1| PREDICTED: ELMO domain-containing protein A-like isoform X2 [Citrus sinensis] Length = 250 Score = 82.0 bits (201), Expect = 8e-14 Identities = 38/45 (84%), Positives = 44/45 (97%) Frame = -2 Query: 329 KQWLERNASYMEFNDVLKSTRAQLERELIMDNVLRIEDMPSFGLL 195 KQWLERNA+YMEFNDVLKSTRAQLEREL+MD+VL+IE+MPS+ LL Sbjct: 205 KQWLERNATYMEFNDVLKSTRAQLERELLMDDVLQIEEMPSYSLL 249 >ref|XP_006484089.1| PREDICTED: ELMO domain-containing protein A-like isoform X1 [Citrus sinensis] Length = 275 Score = 82.0 bits (201), Expect = 8e-14 Identities = 38/45 (84%), Positives = 44/45 (97%) Frame = -2 Query: 329 KQWLERNASYMEFNDVLKSTRAQLERELIMDNVLRIEDMPSFGLL 195 KQWLERNA+YMEFNDVLKSTRAQLEREL+MD+VL+IE+MPS+ LL Sbjct: 230 KQWLERNATYMEFNDVLKSTRAQLERELLMDDVLQIEEMPSYSLL 274 >ref|XP_006438044.1| hypothetical protein CICLE_v10032373mg [Citrus clementina] gi|557540240|gb|ESR51284.1| hypothetical protein CICLE_v10032373mg [Citrus clementina] Length = 275 Score = 82.0 bits (201), Expect = 8e-14 Identities = 38/45 (84%), Positives = 44/45 (97%) Frame = -2 Query: 329 KQWLERNASYMEFNDVLKSTRAQLERELIMDNVLRIEDMPSFGLL 195 KQWLERNA+YMEFNDVLKSTRAQLEREL+MD+VL+IE+MPS+ LL Sbjct: 230 KQWLERNATYMEFNDVLKSTRAQLERELLMDDVLQIEEMPSYSLL 274 >ref|XP_006438042.1| hypothetical protein CICLE_v10032373mg [Citrus clementina] gi|557540238|gb|ESR51282.1| hypothetical protein CICLE_v10032373mg [Citrus clementina] Length = 190 Score = 82.0 bits (201), Expect = 8e-14 Identities = 38/45 (84%), Positives = 44/45 (97%) Frame = -2 Query: 329 KQWLERNASYMEFNDVLKSTRAQLERELIMDNVLRIEDMPSFGLL 195 KQWLERNA+YMEFNDVLKSTRAQLEREL+MD+VL+IE+MPS+ LL Sbjct: 145 KQWLERNATYMEFNDVLKSTRAQLERELLMDDVLQIEEMPSYSLL 189 >ref|XP_006438041.1| hypothetical protein CICLE_v10032373mg [Citrus clementina] gi|557540237|gb|ESR51281.1| hypothetical protein CICLE_v10032373mg [Citrus clementina] Length = 240 Score = 82.0 bits (201), Expect = 8e-14 Identities = 38/45 (84%), Positives = 44/45 (97%) Frame = -2 Query: 329 KQWLERNASYMEFNDVLKSTRAQLERELIMDNVLRIEDMPSFGLL 195 KQWLERNA+YMEFNDVLKSTRAQLEREL+MD+VL+IE+MPS+ LL Sbjct: 195 KQWLERNATYMEFNDVLKSTRAQLERELLMDDVLQIEEMPSYSLL 239 >ref|XP_002514926.1| ELMO domain-containing protein, putative [Ricinus communis] gi|223545977|gb|EEF47480.1| ELMO domain-containing protein, putative [Ricinus communis] Length = 259 Score = 82.0 bits (201), Expect = 8e-14 Identities = 38/45 (84%), Positives = 43/45 (95%) Frame = -2 Query: 329 KQWLERNASYMEFNDVLKSTRAQLERELIMDNVLRIEDMPSFGLL 195 KQWLERNA+YMEFNDVLK TRAQ+EREL+MD+VLRIEDMPS+ LL Sbjct: 214 KQWLERNATYMEFNDVLKCTRAQVERELLMDDVLRIEDMPSYSLL 258 >ref|XP_002315612.2| hypothetical protein POPTR_0010s07040g [Populus trichocarpa] gi|550329264|gb|EEF01783.2| hypothetical protein POPTR_0010s07040g [Populus trichocarpa] Length = 285 Score = 80.1 bits (196), Expect = 3e-13 Identities = 37/44 (84%), Positives = 42/44 (95%) Frame = -2 Query: 326 QWLERNASYMEFNDVLKSTRAQLERELIMDNVLRIEDMPSFGLL 195 QWL RNA+YMEFNDVLKSTRAQ+EREL+MD+VLRIEDMPS+ LL Sbjct: 241 QWLHRNATYMEFNDVLKSTRAQVERELLMDDVLRIEDMPSYSLL 284 >ref|XP_006601899.1| PREDICTED: ELMO domain-containing protein A-like isoform X2 [Glycine max] Length = 247 Score = 79.7 bits (195), Expect = 4e-13 Identities = 37/45 (82%), Positives = 42/45 (93%) Frame = -2 Query: 329 KQWLERNASYMEFNDVLKSTRAQLERELIMDNVLRIEDMPSFGLL 195 K WLERNA+YMEFNDVLKSTR QLE+EL+MD+VLRIEDMPS+ LL Sbjct: 202 KLWLERNATYMEFNDVLKSTRVQLEKELLMDDVLRIEDMPSYSLL 246