BLASTX nr result
ID: Paeonia22_contig00046197
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00046197 (269 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002280555.2| PREDICTED: dehydration-responsive element-bi... 60 4e-07 >ref|XP_002280555.2| PREDICTED: dehydration-responsive element-binding protein 3-like [Vitis vinifera] Length = 266 Score = 59.7 bits (143), Expect = 4e-07 Identities = 26/47 (55%), Positives = 37/47 (78%) Frame = -1 Query: 242 SELVLVDSIDGWIYPPPELLEADFCGYFTENISSASDCVIPSSYEAL 102 ++ V VDS+DGW+YPPP L AD CGYF+E++ +D +IP+S+EAL Sbjct: 217 NDFVFVDSVDGWLYPPPWLHTADDCGYFSEHL-PITDTLIPTSFEAL 262