BLASTX nr result
ID: Paeonia22_contig00046162
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00046162 (322 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACN78973.1| copia-type polyprotein [Glycine max] gi|225016157... 63 5e-11 gb|AGW47867.1| polyprotein [Phaseolus vulgaris] 57 1e-07 gb|AAF16534.1|AC013482_8 T26F17.17 [Arabidopsis thaliana] 58 1e-06 emb|CAA69272.1| lectin receptor kinase [Arabidopsis thaliana] 58 1e-06 emb|CAB75469.1| copia-type reverse transcriptase-like protein [A... 58 1e-06 gb|AAG60117.1|AC073555_1 copia-type polyprotein, putative [Arabi... 57 3e-06 emb|CAB71063.1| copia-type polyprotein [Arabidopsis thaliana] 57 3e-06 gb|AAD50001.1|AC007259_14 Hypothetical protein [Arabidopsis thal... 57 3e-06 gb|AAG50698.1|AC079604_5 copia-type polyprotein, putative [Arabi... 56 6e-06 dbj|BAB01972.1| copia-like retrotransposable element [Arabidopsi... 45 1e-05 >gb|ACN78973.1| copia-type polyprotein [Glycine max] gi|225016157|gb|ACN78980.1| copia-type polyprotein [Glycine max] Length = 1042 Score = 62.8 bits (151), Expect(2) = 5e-11 Identities = 26/49 (53%), Positives = 38/49 (77%) Frame = +3 Query: 147 CFMTVSEPIGFEEVFKEKKQRGAIDEEVKAIEKNNMWEITSLPKGLKAL 293 C S+P+ F+E K+K+ R A++EE+KAIEKNN WE++SLPKG +A+ Sbjct: 521 CLFVDSKPLNFDEAMKDKRWRQAMEEEIKAIEKNNTWELSSLPKGHEAI 569 Score = 30.0 bits (66), Expect(2) = 5e-11 Identities = 20/47 (42%), Positives = 25/47 (53%) Frame = +1 Query: 4 LPQTPTQTHLSLYRGESSSSVGPRIKRKLHDLYEETKEIEGDEFTLF 144 L TP+ S E SSS PR R + +LY+ET E+ D F LF Sbjct: 479 LSPTPSTNEASS-SSEGSSSERPRRMRNIQELYDET-EVINDLFCLF 523 >gb|AGW47867.1| polyprotein [Phaseolus vulgaris] Length = 1471 Score = 57.0 bits (136), Expect(2) = 1e-07 Identities = 23/46 (50%), Positives = 35/46 (76%) Frame = +3 Query: 144 LCFMTVSEPIGFEEVFKEKKQRGAIDEEVKAIEKNNMWEITSLPKG 281 +C + +E I FEE ++KK + A+DEE+KAI++NN WE+T LP+G Sbjct: 829 VCLLADAENISFEEAVRDKKWQTAMDEEIKAIDRNNTWELTELPEG 874 Score = 24.3 bits (51), Expect(2) = 1e-07 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = +1 Query: 70 PRIKRKLHDLYEETKEIEGDEFTLFCVL 153 P+I R LHDLY+ T E+ L C+L Sbjct: 811 PKI-RSLHDLYDSTNEVH-----LVCLL 832 >gb|AAF16534.1|AC013482_8 T26F17.17 [Arabidopsis thaliana] Length = 1291 Score = 58.2 bits (139), Expect = 1e-06 Identities = 24/49 (48%), Positives = 35/49 (71%) Frame = +3 Query: 147 CFMTVSEPIGFEEVFKEKKQRGAIDEEVKAIEKNNMWEITSLPKGLKAL 293 C EP+ F+E ++K R A+DEE+K+I+KN+ WE+TSLP G KA+ Sbjct: 770 CLFAECEPMDFQEAIEKKTWRNAMDEEIKSIQKNDTWELTSLPNGHKAI 818 >emb|CAA69272.1| lectin receptor kinase [Arabidopsis thaliana] Length = 623 Score = 58.2 bits (139), Expect = 1e-06 Identities = 24/49 (48%), Positives = 35/49 (71%) Frame = +3 Query: 147 CFMTVSEPIGFEEVFKEKKQRGAIDEEVKAIEKNNMWEITSLPKGLKAL 293 C EP+ F+E ++K R A+DEE+K+I+KN+ WE+TSLP G KA+ Sbjct: 328 CLFAECEPMDFQEAIEKKTWRNAMDEEIKSIQKNDTWELTSLPNGHKAI 376 >emb|CAB75469.1| copia-type reverse transcriptase-like protein [Arabidopsis thaliana] Length = 1272 Score = 58.2 bits (139), Expect = 1e-06 Identities = 24/49 (48%), Positives = 35/49 (71%) Frame = +3 Query: 147 CFMTVSEPIGFEEVFKEKKQRGAIDEEVKAIEKNNMWEITSLPKGLKAL 293 C EP+ F+E ++K R A+DEE+K+I+KN+ WE+TSLP G KA+ Sbjct: 831 CLFAECEPMDFQEAIEKKTWRNAMDEEIKSIQKNDTWELTSLPNGHKAI 879 >gb|AAG60117.1|AC073555_1 copia-type polyprotein, putative [Arabidopsis thaliana] Length = 1352 Score = 56.6 bits (135), Expect = 3e-06 Identities = 23/49 (46%), Positives = 34/49 (69%) Frame = +3 Query: 147 CFMTVSEPIGFEEVFKEKKQRGAIDEEVKAIEKNNMWEITSLPKGLKAL 293 C EP+ F+E ++K R A+DEE+K+I+KN+ WE+TSLP G K + Sbjct: 831 CLFAECEPMDFQEAIEKKTWRNAMDEEIKSIQKNDTWELTSLPNGHKTI 879 >emb|CAB71063.1| copia-type polyprotein [Arabidopsis thaliana] Length = 1352 Score = 56.6 bits (135), Expect = 3e-06 Identities = 23/49 (46%), Positives = 35/49 (71%) Frame = +3 Query: 147 CFMTVSEPIGFEEVFKEKKQRGAIDEEVKAIEKNNMWEITSLPKGLKAL 293 C EP+ F++ ++K R A+DEE+K+I+KN+ WE+TSLP G KA+ Sbjct: 831 CLFAECEPMDFQKAIEKKTWRNAMDEEIKSIQKNDTWELTSLPNGHKAI 879 >gb|AAD50001.1|AC007259_14 Hypothetical protein [Arabidopsis thaliana] Length = 1352 Score = 56.6 bits (135), Expect = 3e-06 Identities = 23/49 (46%), Positives = 35/49 (71%) Frame = +3 Query: 147 CFMTVSEPIGFEEVFKEKKQRGAIDEEVKAIEKNNMWEITSLPKGLKAL 293 C EP+ F++ ++K R A+DEE+K+I+KN+ WE+TSLP G KA+ Sbjct: 831 CLFAECEPMDFQKAIEKKTWRNAMDEEIKSIQKNDTWELTSLPNGHKAI 879 >gb|AAG50698.1|AC079604_5 copia-type polyprotein, putative [Arabidopsis thaliana] gi|12321387|gb|AAG50765.1|AC079131_10 copia-type polyprotein, putative [Arabidopsis thaliana] Length = 1320 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/43 (53%), Positives = 34/43 (79%) Frame = +3 Query: 165 EPIGFEEVFKEKKQRGAIDEEVKAIEKNNMWEITSLPKGLKAL 293 EP+ F+E ++K R A+DEE+K+I+KN+ WE+TSLP G KA+ Sbjct: 805 EPMDFQEAIEKKTWRNAMDEEIKSIQKNDTWELTSLPNGHKAI 847 >dbj|BAB01972.1| copia-like retrotransposable element [Arabidopsis thaliana] Length = 1499 Score = 44.7 bits (104), Expect(2) = 1e-05 Identities = 19/45 (42%), Positives = 27/45 (60%) Frame = +3 Query: 144 LCFMTVSEPIGFEEVFKEKKQRGAIDEEVKAIEKNNMWEITSLPK 278 +C M EP EE K++K A+ EE++ IEKN WE+ + PK Sbjct: 833 MCLMMAEEPQALEEAMKDEKWIEAMREELRMIEKNKTWEVVARPK 877 Score = 30.0 bits (66), Expect(2) = 1e-05 Identities = 12/27 (44%), Positives = 19/27 (70%) Frame = +1 Query: 49 ESSSSVGPRIKRKLHDLYEETKEIEGD 129 E SVGPR R +++L ++T E+EG+ Sbjct: 801 EGEESVGPRGFRSINNLMDQTNEVEGE 827