BLASTX nr result
ID: Paeonia22_contig00045859
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00045859 (364 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002526688.1| conserved hypothetical protein [Ricinus comm... 49 1e-06 >ref|XP_002526688.1| conserved hypothetical protein [Ricinus communis] gi|223533988|gb|EEF35710.1| conserved hypothetical protein [Ricinus communis] Length = 890 Score = 48.9 bits (115), Expect(2) = 1e-06 Identities = 20/33 (60%), Positives = 26/33 (78%) Frame = -3 Query: 101 EGCVRSAAVCAVSEWGQLLVGSNQDRDKSDWSD 3 + CVRSAAV VSEWG +L+ +NQ+ DK+DW D Sbjct: 197 DDCVRSAAVNLVSEWGLMLIAANQEEDKTDWFD 229 Score = 28.9 bits (63), Expect(2) = 1e-06 Identities = 15/37 (40%), Positives = 22/37 (59%) Frame = -2 Query: 213 VRIFTLDGLVKSRKTIICDDRDMIQGCYCCDIELSGD 103 VR L+GLV K + +D+ +I+GCY +EL D Sbjct: 159 VRKEALNGLVSLCKYGVFEDKSVIEGCYRRGVELLKD 195