BLASTX nr result
ID: Paeonia22_contig00045839
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00045839 (251 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002324235.2| pentatricopeptide repeat-containing family p... 113 2e-23 ref|XP_006475804.1| PREDICTED: pentatricopeptide repeat-containi... 113 3e-23 ref|XP_006450982.1| hypothetical protein CICLE_v10010823mg [Citr... 113 3e-23 gb|EXB86239.1| hypothetical protein L484_005950 [Morus notabilis] 112 5e-23 ref|XP_002274432.1| PREDICTED: pentatricopeptide repeat-containi... 112 5e-23 ref|XP_006364895.1| PREDICTED: pentatricopeptide repeat-containi... 111 9e-23 ref|XP_007013366.1| Pentatricopeptide repeat-containing protein,... 111 1e-22 ref|XP_007154976.1| hypothetical protein PHAVU_003G162300g [Phas... 108 8e-22 ref|XP_004150015.1| PREDICTED: pentatricopeptide repeat-containi... 108 8e-22 ref|XP_003609266.1| Pentatricopeptide repeat protein [Medicago t... 108 8e-22 gb|EYU45574.1| hypothetical protein MIMGU_mgv1a001941mg [Mimulus... 107 2e-21 ref|XP_004508527.1| PREDICTED: pentatricopeptide repeat-containi... 105 5e-21 ref|XP_007203957.1| hypothetical protein PRUPE_ppa022872mg [Prun... 104 1e-20 ref|XP_003525660.2| PREDICTED: pentatricopeptide repeat-containi... 103 2e-20 ref|XP_004975979.1| PREDICTED: pentatricopeptide repeat-containi... 102 4e-20 emb|CBI28813.3| unnamed protein product [Vitis vinifera] 102 5e-20 ref|XP_002269269.1| PREDICTED: pentatricopeptide repeat-containi... 102 5e-20 ref|XP_004288820.1| PREDICTED: pentatricopeptide repeat-containi... 102 7e-20 ref|XP_006483347.1| PREDICTED: pentatricopeptide repeat-containi... 100 3e-19 ref|XP_006483346.1| PREDICTED: pentatricopeptide repeat-containi... 100 3e-19 >ref|XP_002324235.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|550317719|gb|EEF02800.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 736 Score = 113 bits (283), Expect = 2e-23 Identities = 50/53 (94%), Positives = 52/53 (98%) Frame = -3 Query: 249 GTTIRIVKNLRVCGNCHAATKLISKIFNREIIARDRNRFHHFKDGSCSCMDYW 91 GTTIRI+KNLRVCGNCH+ATKLISKIFNREIIARDRNRFHHFKDGSCSC DYW Sbjct: 684 GTTIRIMKNLRVCGNCHSATKLISKIFNREIIARDRNRFHHFKDGSCSCKDYW 736 >ref|XP_006475804.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Citrus sinensis] Length = 736 Score = 113 bits (282), Expect = 3e-23 Identities = 50/53 (94%), Positives = 52/53 (98%) Frame = -3 Query: 249 GTTIRIVKNLRVCGNCHAATKLISKIFNREIIARDRNRFHHFKDGSCSCMDYW 91 GTTIRIVKNLRVCGNCH+ATKLISKIFNREIIARDRNRFHHFKDG+CSC DYW Sbjct: 684 GTTIRIVKNLRVCGNCHSATKLISKIFNREIIARDRNRFHHFKDGNCSCNDYW 736 >ref|XP_006450982.1| hypothetical protein CICLE_v10010823mg [Citrus clementina] gi|557554208|gb|ESR64222.1| hypothetical protein CICLE_v10010823mg [Citrus clementina] Length = 736 Score = 113 bits (282), Expect = 3e-23 Identities = 50/53 (94%), Positives = 52/53 (98%) Frame = -3 Query: 249 GTTIRIVKNLRVCGNCHAATKLISKIFNREIIARDRNRFHHFKDGSCSCMDYW 91 GTTIRIVKNLRVCGNCH+ATKLISKIFNREIIARDRNRFHHFKDG+CSC DYW Sbjct: 684 GTTIRIVKNLRVCGNCHSATKLISKIFNREIIARDRNRFHHFKDGNCSCNDYW 736 >gb|EXB86239.1| hypothetical protein L484_005950 [Morus notabilis] Length = 737 Score = 112 bits (280), Expect = 5e-23 Identities = 50/53 (94%), Positives = 52/53 (98%) Frame = -3 Query: 249 GTTIRIVKNLRVCGNCHAATKLISKIFNREIIARDRNRFHHFKDGSCSCMDYW 91 GTTIRIVKNLRVCGNCH+ATKLISKIFNREIIARDRNRFHHFK+GSCSC DYW Sbjct: 685 GTTIRIVKNLRVCGNCHSATKLISKIFNREIIARDRNRFHHFKNGSCSCNDYW 737 >ref|XP_002274432.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Vitis vinifera] Length = 738 Score = 112 bits (280), Expect = 5e-23 Identities = 50/52 (96%), Positives = 51/52 (98%) Frame = -3 Query: 246 TTIRIVKNLRVCGNCHAATKLISKIFNREIIARDRNRFHHFKDGSCSCMDYW 91 TTIRIVKNLRVCGNCH+A KLISKIFNREIIARDRNRFHHFKDGSCSCMDYW Sbjct: 687 TTIRIVKNLRVCGNCHSAIKLISKIFNREIIARDRNRFHHFKDGSCSCMDYW 738 >ref|XP_006364895.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Solanum tuberosum] Length = 731 Score = 111 bits (278), Expect = 9e-23 Identities = 48/53 (90%), Positives = 52/53 (98%) Frame = -3 Query: 249 GTTIRIVKNLRVCGNCHAATKLISKIFNREIIARDRNRFHHFKDGSCSCMDYW 91 GTT+RIVKNLRVCGNCH ATK+ISKIFNREIIARDRNRFHHFK+GSCSC+DYW Sbjct: 679 GTTLRIVKNLRVCGNCHEATKMISKIFNREIIARDRNRFHHFKNGSCSCLDYW 731 >ref|XP_007013366.1| Pentatricopeptide repeat-containing protein, putative [Theobroma cacao] gi|508783729|gb|EOY30985.1| Pentatricopeptide repeat-containing protein, putative [Theobroma cacao] Length = 194 Score = 111 bits (277), Expect = 1e-22 Identities = 49/53 (92%), Positives = 51/53 (96%) Frame = -3 Query: 249 GTTIRIVKNLRVCGNCHAATKLISKIFNREIIARDRNRFHHFKDGSCSCMDYW 91 GTTIRIVKNLRVCGNCH+ATKLISKIFN+EIIARDRNRFHHFKDG CSC DYW Sbjct: 142 GTTIRIVKNLRVCGNCHSATKLISKIFNKEIIARDRNRFHHFKDGFCSCKDYW 194 >ref|XP_007154976.1| hypothetical protein PHAVU_003G162300g [Phaseolus vulgaris] gi|561028330|gb|ESW26970.1| hypothetical protein PHAVU_003G162300g [Phaseolus vulgaris] Length = 733 Score = 108 bits (270), Expect = 8e-22 Identities = 49/53 (92%), Positives = 50/53 (94%) Frame = -3 Query: 249 GTTIRIVKNLRVCGNCHAATKLISKIFNREIIARDRNRFHHFKDGSCSCMDYW 91 GTTIRIVKNLRVCGNCH+ATKLISKIFNREIIARDRNRFHHFKDG CSC D W Sbjct: 681 GTTIRIVKNLRVCGNCHSATKLISKIFNREIIARDRNRFHHFKDGFCSCNDCW 733 >ref|XP_004150015.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Cucumis sativus] gi|449529868|ref|XP_004171920.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Cucumis sativus] Length = 734 Score = 108 bits (270), Expect = 8e-22 Identities = 48/53 (90%), Positives = 50/53 (94%) Frame = -3 Query: 249 GTTIRIVKNLRVCGNCHAATKLISKIFNREIIARDRNRFHHFKDGSCSCMDYW 91 GT IRI+KNLRVC NCH+ATKLISKIFNREIIARDRNRFHHFKDGSCSC DYW Sbjct: 682 GTPIRIIKNLRVCRNCHSATKLISKIFNREIIARDRNRFHHFKDGSCSCNDYW 734 >ref|XP_003609266.1| Pentatricopeptide repeat protein [Medicago truncatula] gi|355510321|gb|AES91463.1| Pentatricopeptide repeat protein [Medicago truncatula] Length = 738 Score = 108 bits (270), Expect = 8e-22 Identities = 49/53 (92%), Positives = 50/53 (94%) Frame = -3 Query: 249 GTTIRIVKNLRVCGNCHAATKLISKIFNREIIARDRNRFHHFKDGSCSCMDYW 91 GTTIRIVKNLRVCGNCH+ATKLISKIFNREIIARDRNRFHHFKDG CSC D W Sbjct: 686 GTTIRIVKNLRVCGNCHSATKLISKIFNREIIARDRNRFHHFKDGFCSCNDCW 738 >gb|EYU45574.1| hypothetical protein MIMGU_mgv1a001941mg [Mimulus guttatus] Length = 736 Score = 107 bits (267), Expect = 2e-21 Identities = 46/53 (86%), Positives = 51/53 (96%) Frame = -3 Query: 249 GTTIRIVKNLRVCGNCHAATKLISKIFNREIIARDRNRFHHFKDGSCSCMDYW 91 GTT+RIVKNLRVCGNCH+ATKLISK++ REIIARDR+RFH FKDGSCSCMDYW Sbjct: 684 GTTLRIVKNLRVCGNCHSATKLISKVYGREIIARDRSRFHRFKDGSCSCMDYW 736 >ref|XP_004508527.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Cicer arietinum] Length = 737 Score = 105 bits (263), Expect = 5e-21 Identities = 47/53 (88%), Positives = 50/53 (94%) Frame = -3 Query: 249 GTTIRIVKNLRVCGNCHAATKLISKIFNREIIARDRNRFHHFKDGSCSCMDYW 91 G+TIRIVKNLRVCGNCH+ATKLISKIFNR+IIARDRNRFHHFKDG CSC D W Sbjct: 685 GSTIRIVKNLRVCGNCHSATKLISKIFNRQIIARDRNRFHHFKDGFCSCNDCW 737 >ref|XP_007203957.1| hypothetical protein PRUPE_ppa022872mg [Prunus persica] gi|462399488|gb|EMJ05156.1| hypothetical protein PRUPE_ppa022872mg [Prunus persica] Length = 714 Score = 104 bits (260), Expect = 1e-20 Identities = 47/53 (88%), Positives = 49/53 (92%) Frame = -3 Query: 249 GTTIRIVKNLRVCGNCHAATKLISKIFNREIIARDRNRFHHFKDGSCSCMDYW 91 GTTIRIVKNLRVC NCH+ATKLISKIFNREIIARD NRFHHF+DGSCSC D W Sbjct: 662 GTTIRIVKNLRVCANCHSATKLISKIFNREIIARDGNRFHHFRDGSCSCNDNW 714 >ref|XP_003525660.2| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Glycine max] Length = 737 Score = 103 bits (258), Expect = 2e-20 Identities = 47/53 (88%), Positives = 49/53 (92%) Frame = -3 Query: 249 GTTIRIVKNLRVCGNCHAATKLISKIFNREIIARDRNRFHHFKDGSCSCMDYW 91 G+TIRIVKNLRVC NCH+ATKLISKIFNREIIARDRNRFHHFKDG CSC D W Sbjct: 685 GSTIRIVKNLRVCRNCHSATKLISKIFNREIIARDRNRFHHFKDGFCSCNDRW 737 >ref|XP_004975979.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Setaria italica] Length = 695 Score = 102 bits (255), Expect = 4e-20 Identities = 43/53 (81%), Positives = 49/53 (92%) Frame = -3 Query: 249 GTTIRIVKNLRVCGNCHAATKLISKIFNREIIARDRNRFHHFKDGSCSCMDYW 91 GTTIR+ KNLRVC +CH+ATKLISK++NREI+ RDRNRFHHFKDGSCSC DYW Sbjct: 643 GTTIRLSKNLRVCTDCHSATKLISKVYNREIVVRDRNRFHHFKDGSCSCNDYW 695 >emb|CBI28813.3| unnamed protein product [Vitis vinifera] Length = 500 Score = 102 bits (254), Expect = 5e-20 Identities = 44/53 (83%), Positives = 49/53 (92%) Frame = -3 Query: 249 GTTIRIVKNLRVCGNCHAATKLISKIFNREIIARDRNRFHHFKDGSCSCMDYW 91 GTTIRI KNLRVC +CH+ATKLISKI+NREII RDR RFHHF+DGSCSCMD+W Sbjct: 448 GTTIRITKNLRVCADCHSATKLISKIYNREIIVRDRCRFHHFRDGSCSCMDFW 500 >ref|XP_002269269.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Vitis vinifera] Length = 640 Score = 102 bits (254), Expect = 5e-20 Identities = 44/53 (83%), Positives = 49/53 (92%) Frame = -3 Query: 249 GTTIRIVKNLRVCGNCHAATKLISKIFNREIIARDRNRFHHFKDGSCSCMDYW 91 GTTIRI KNLRVC +CH+ATKLISKI+NREII RDR RFHHF+DGSCSCMD+W Sbjct: 588 GTTIRITKNLRVCADCHSATKLISKIYNREIIVRDRCRFHHFRDGSCSCMDFW 640 >ref|XP_004288820.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Fragaria vesca subsp. vesca] Length = 659 Score = 102 bits (253), Expect = 7e-20 Identities = 43/53 (81%), Positives = 48/53 (90%) Frame = -3 Query: 249 GTTIRIVKNLRVCGNCHAATKLISKIFNREIIARDRNRFHHFKDGSCSCMDYW 91 GTTIR+VKNLRVC +CH ATKLISK++NREII RDRNRFH FKDGSCSC D+W Sbjct: 607 GTTIRVVKNLRVCSDCHTATKLISKVYNREIIVRDRNRFHQFKDGSCSCKDFW 659 >ref|XP_006483347.1| PREDICTED: pentatricopeptide repeat-containing protein At1g59720, mitochondrial-like isoform X2 [Citrus sinensis] Length = 566 Score = 100 bits (248), Expect = 3e-19 Identities = 42/53 (79%), Positives = 48/53 (90%) Frame = -3 Query: 249 GTTIRIVKNLRVCGNCHAATKLISKIFNREIIARDRNRFHHFKDGSCSCMDYW 91 GT IRIVKNLRVC +CH+ATK ISKI+NREI+ RDR+RFHHFKDGSCSC D+W Sbjct: 514 GTPIRIVKNLRVCNDCHSATKFISKIYNREIVVRDRHRFHHFKDGSCSCRDFW 566 >ref|XP_006483346.1| PREDICTED: pentatricopeptide repeat-containing protein At1g59720, mitochondrial-like isoform X1 [Citrus sinensis] Length = 600 Score = 100 bits (248), Expect = 3e-19 Identities = 42/53 (79%), Positives = 48/53 (90%) Frame = -3 Query: 249 GTTIRIVKNLRVCGNCHAATKLISKIFNREIIARDRNRFHHFKDGSCSCMDYW 91 GT IRIVKNLRVC +CH+ATK ISKI+NREI+ RDR+RFHHFKDGSCSC D+W Sbjct: 548 GTPIRIVKNLRVCNDCHSATKFISKIYNREIVVRDRHRFHHFKDGSCSCRDFW 600