BLASTX nr result
ID: Paeonia22_contig00045810
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00045810 (257 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004144290.1| PREDICTED: pentatricopeptide repeat-containi... 97 3e-18 ref|XP_002276453.1| PREDICTED: pentatricopeptide repeat-containi... 96 7e-18 emb|CAN80799.1| hypothetical protein VITISV_019809 [Vitis vinifera] 96 7e-18 ref|XP_007226363.1| hypothetical protein PRUPE_ppa022421mg [Prun... 87 2e-15 ref|XP_002882332.1| hypothetical protein ARALYDRAFT_896436 [Arab... 86 7e-15 ref|XP_006442168.1| hypothetical protein CICLE_v10018770mg [Citr... 80 3e-13 ref|XP_006300966.1| hypothetical protein CARUB_v10021355mg, part... 80 3e-13 ref|XP_006279977.1| hypothetical protein CARUB_v10025847mg [Caps... 79 6e-13 ref|XP_002866679.1| pentatricopeptide repeat-containing protein ... 79 8e-13 ref|XP_004512571.1| PREDICTED: pentatricopeptide repeat-containi... 78 1e-12 ref|XP_006492780.1| PREDICTED: pentatricopeptide repeat-containi... 77 2e-12 ref|XP_006492779.1| PREDICTED: pentatricopeptide repeat-containi... 77 2e-12 ref|XP_007214342.1| hypothetical protein PRUPE_ppa027136mg, part... 77 3e-12 ref|XP_007140312.1| hypothetical protein PHAVU_008G101600g [Phas... 74 2e-11 ref|XP_006381417.1| pentatricopeptide repeat-containing family p... 72 6e-11 ref|NP_201359.1| pentatricopeptide repeat-containing protein [Ar... 72 1e-10 ref|XP_007158351.1| hypothetical protein PHAVU_002G145400g [Phas... 70 3e-10 ref|XP_007047758.1| Pentatricopeptide repeat (PPR) superfamily p... 70 4e-10 ref|XP_003613018.1| Pentatricopeptide repeat-containing protein ... 70 4e-10 ref|XP_003533421.1| PREDICTED: pentatricopeptide repeat-containi... 68 1e-09 >ref|XP_004144290.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like [Cucumis sativus] gi|449522905|ref|XP_004168466.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like [Cucumis sativus] Length = 915 Score = 96.7 bits (239), Expect = 3e-18 Identities = 49/85 (57%), Positives = 60/85 (70%), Gaps = 1/85 (1%) Frame = +2 Query: 5 IDHKPLSSNPMLPNG-EPEPVHPSQIFSLLSSPNWQKNPSLRKLIPFIEPSHLSSLFSFN 181 I H+ +S LP E P+Q+FS+LS PNWQK+PSL+ LIP I PSH+S+LF+ N Sbjct: 28 ITHRFFTSPASLPQSFSVEHDIPAQLFSILSRPNWQKHPSLKNLIPSIAPSHISALFALN 87 Query: 182 LDPQIALTFFNWIPQQKSGFKHNAE 256 LDPQ AL FFNWI QK GFKHN + Sbjct: 88 LDPQTALAFFNWI-GQKHGFKHNVQ 111 >ref|XP_002276453.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560 [Vitis vinifera] gi|296084392|emb|CBI24780.3| unnamed protein product [Vitis vinifera] Length = 890 Score = 95.5 bits (236), Expect = 7e-18 Identities = 51/83 (61%), Positives = 62/83 (74%), Gaps = 4/83 (4%) Frame = +2 Query: 14 KPLSSNPMLP---NGEPEPVHPS-QIFSLLSSPNWQKNPSLRKLIPFIEPSHLSSLFSFN 181 KP SS LP + + EPV S Q+ S+LS PNWQK+PSLRKL+P + PSH+SSLF+FN Sbjct: 19 KPYSSIASLPQILSLDSEPVDLSAQLLSILSRPNWQKHPSLRKLLPSLTPSHVSSLFAFN 78 Query: 182 LDPQIALTFFNWIPQQKSGFKHN 250 LDPQ AL+FFNWI + GFKHN Sbjct: 79 LDPQTALSFFNWI-ALRPGFKHN 100 >emb|CAN80799.1| hypothetical protein VITISV_019809 [Vitis vinifera] Length = 1099 Score = 95.5 bits (236), Expect = 7e-18 Identities = 51/83 (61%), Positives = 62/83 (74%), Gaps = 4/83 (4%) Frame = +2 Query: 14 KPLSSNPMLP---NGEPEPVHPS-QIFSLLSSPNWQKNPSLRKLIPFIEPSHLSSLFSFN 181 KP SS LP + + EPV S Q+ S+LS PNWQK+PSLRKL+P + PSH+SSLF+FN Sbjct: 19 KPYSSIASLPQILSLDSEPVDLSAQLLSILSRPNWQKHPSLRKLLPSLTPSHVSSLFAFN 78 Query: 182 LDPQIALTFFNWIPQQKSGFKHN 250 LDPQ AL+FFNWI + GFKHN Sbjct: 79 LDPQTALSFFNWI-ALRPGFKHN 100 >ref|XP_007226363.1| hypothetical protein PRUPE_ppa022421mg [Prunus persica] gi|462423299|gb|EMJ27562.1| hypothetical protein PRUPE_ppa022421mg [Prunus persica] Length = 845 Score = 87.4 bits (215), Expect = 2e-15 Identities = 43/76 (56%), Positives = 57/76 (75%), Gaps = 1/76 (1%) Frame = +2 Query: 23 SSNPMLPNGEPEPVH-PSQIFSLLSSPNWQKNPSLRKLIPFIEPSHLSSLFSFNLDPQIA 199 +++P LP +PV SQ+F++LS PNWQ++PSL+KLIP I SH+SSLF+ NLDPQ A Sbjct: 39 AASPSLPPVPEQPVDLSSQLFAILSRPNWQRHPSLKKLIPSISASHVSSLFALNLDPQTA 98 Query: 200 LTFFNWIPQQKSGFKH 247 L FFNWI K G++H Sbjct: 99 LGFFNWI-ALKPGYRH 113 >ref|XP_002882332.1| hypothetical protein ARALYDRAFT_896436 [Arabidopsis lyrata subsp. lyrata] gi|297328172|gb|EFH58591.1| hypothetical protein ARALYDRAFT_896436 [Arabidopsis lyrata subsp. lyrata] Length = 790 Score = 85.5 bits (210), Expect = 7e-15 Identities = 45/85 (52%), Positives = 52/85 (61%), Gaps = 5/85 (5%) Frame = +2 Query: 17 PLSSNPML----PNGEPEPVH-PSQIFSLLSSPNWQKNPSLRKLIPFIEPSHLSSLFSFN 181 P SS L P E +P H P + S+LS PNWQ NPSL+ L+P I PSH+SSLFS N Sbjct: 19 PFSSTSTLLHTPPEAESDPSHLPHHLLSILSKPNWQNNPSLKSLLPAITPSHVSSLFSLN 78 Query: 182 LDPQIALTFFNWIPQQKSGFKHNAE 256 LDP AL F WI Q FKHN + Sbjct: 79 LDPHTALQFSYWI-SQTPNFKHNVD 102 >ref|XP_006442168.1| hypothetical protein CICLE_v10018770mg [Citrus clementina] gi|557544430|gb|ESR55408.1| hypothetical protein CICLE_v10018770mg [Citrus clementina] Length = 910 Score = 80.1 bits (196), Expect = 3e-13 Identities = 43/81 (53%), Positives = 58/81 (71%), Gaps = 2/81 (2%) Frame = +2 Query: 20 LSSNPMLPNGEPEPVHPSQIFSLLSS--PNWQKNPSLRKLIPFIEPSHLSSLFSFNLDPQ 193 +SS P+ + +P P PSQIF++LS+ WQ++PS+ KLIP + PSH+SSLFS +L+PQ Sbjct: 32 ISSLPLPLDPDP-PDLPSQIFTILSTHPTTWQRHPSITKLIPLLSPSHISSLFSLDLNPQ 90 Query: 194 IALTFFNWIPQQKSGFKHNAE 256 AL F WI QK GFKH+ E Sbjct: 91 TALDFSYWI-SQKPGFKHSVE 110 >ref|XP_006300966.1| hypothetical protein CARUB_v10021355mg, partial [Capsella rubella] gi|482569676|gb|EOA33864.1| hypothetical protein CARUB_v10021355mg, partial [Capsella rubella] Length = 750 Score = 80.1 bits (196), Expect = 3e-13 Identities = 37/61 (60%), Positives = 44/61 (72%) Frame = +2 Query: 68 PSQIFSLLSSPNWQKNPSLRKLIPFIEPSHLSSLFSFNLDPQIALTFFNWIPQQKSGFKH 247 P Q+ S+ S PNWQ NPSL+ L+P I PSH+SSLFS NLDP AL+F +WI Q FKH Sbjct: 25 PCQLLSIFSEPNWQNNPSLKSLVPAITPSHVSSLFSLNLDPLTALSFSDWISQTPK-FKH 83 Query: 248 N 250 N Sbjct: 84 N 84 >ref|XP_006279977.1| hypothetical protein CARUB_v10025847mg [Capsella rubella] gi|482548681|gb|EOA12875.1| hypothetical protein CARUB_v10025847mg [Capsella rubella] Length = 915 Score = 79.0 bits (193), Expect = 6e-13 Identities = 40/80 (50%), Positives = 55/80 (68%), Gaps = 4/80 (5%) Frame = +2 Query: 23 SSNPM---LPNGEPEPVH-PSQIFSLLSSPNWQKNPSLRKLIPFIEPSHLSSLFSFNLDP 190 S++P+ LP E +P P ++ S+LS PNW K+PSLR ++P I PSH+SSLFS +LDP Sbjct: 44 SASPLIRTLPAEESDPTSVPHRLLSILSKPNWHKSPSLRSMVPAISPSHVSSLFSLDLDP 103 Query: 191 QIALTFFNWIPQQKSGFKHN 250 + AL F +WI Q FKH+ Sbjct: 104 KTALNFSHWI-SQNPRFKHS 122 >ref|XP_002866679.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297312514|gb|EFH42938.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 915 Score = 78.6 bits (192), Expect = 8e-13 Identities = 40/79 (50%), Positives = 53/79 (67%), Gaps = 1/79 (1%) Frame = +2 Query: 17 PLSSNPMLPNGEPEPVH-PSQIFSLLSSPNWQKNPSLRKLIPFIEPSHLSSLFSFNLDPQ 193 PL N LP E +P P ++FS+LS PNW K PSL+ ++P I PSH+SSLFS +LDP+ Sbjct: 47 PLIRN--LPEDESDPTSVPHRLFSILSKPNWHKCPSLKSMVPAISPSHVSSLFSLDLDPK 104 Query: 194 IALTFFNWIPQQKSGFKHN 250 AL F +WI Q +KH+ Sbjct: 105 TALNFSHWI-SQNPRYKHS 122 >ref|XP_004512571.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like isoform X1 [Cicer arietinum] gi|502162660|ref|XP_004512572.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like isoform X2 [Cicer arietinum] Length = 927 Score = 78.2 bits (191), Expect = 1e-12 Identities = 40/78 (51%), Positives = 51/78 (65%) Frame = +2 Query: 14 KPLSSNPMLPNGEPEPVHPSQIFSLLSSPNWQKNPSLRKLIPFIEPSHLSSLFSFNLDPQ 193 KP SS P P+ PSQI+++LS+P W+K+PS LIP + P+H+SSLF+ NL P Sbjct: 23 KPFSSLPQQPD------LPSQIYTILSNPQWRKDPSFNTLIPSLTPTHISSLFNLNLHPL 76 Query: 194 IALTFFNWIPQQKSGFKH 247 AL FF WI QQ GF H Sbjct: 77 TALNFFKWIHQQ-HGFIH 93 >ref|XP_006492780.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like isoform X2 [Citrus sinensis] Length = 910 Score = 77.0 bits (188), Expect = 2e-12 Identities = 42/81 (51%), Positives = 57/81 (70%), Gaps = 2/81 (2%) Frame = +2 Query: 20 LSSNPMLPNGEPEPVHPSQIFSLLSS--PNWQKNPSLRKLIPFIEPSHLSSLFSFNLDPQ 193 +SS P+ + +P P PSQIF++LS+ WQ++ S+ KLIP + PSH+SSLFS +L+PQ Sbjct: 32 ISSLPLPLDPDP-PDLPSQIFTILSTHPTTWQRHTSITKLIPLLSPSHISSLFSLDLNPQ 90 Query: 194 IALTFFNWIPQQKSGFKHNAE 256 AL F WI QK GFKH+ E Sbjct: 91 TALDFSYWI-SQKPGFKHSVE 110 >ref|XP_006492779.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like isoform X1 [Citrus sinensis] Length = 922 Score = 77.0 bits (188), Expect = 2e-12 Identities = 42/81 (51%), Positives = 57/81 (70%), Gaps = 2/81 (2%) Frame = +2 Query: 20 LSSNPMLPNGEPEPVHPSQIFSLLSS--PNWQKNPSLRKLIPFIEPSHLSSLFSFNLDPQ 193 +SS P+ + +P P PSQIF++LS+ WQ++ S+ KLIP + PSH+SSLFS +L+PQ Sbjct: 32 ISSLPLPLDPDP-PDLPSQIFTILSTHPTTWQRHTSITKLIPLLSPSHISSLFSLDLNPQ 90 Query: 194 IALTFFNWIPQQKSGFKHNAE 256 AL F WI QK GFKH+ E Sbjct: 91 TALDFSYWI-SQKPGFKHSVE 110 >ref|XP_007214342.1| hypothetical protein PRUPE_ppa027136mg, partial [Prunus persica] gi|462410207|gb|EMJ15541.1| hypothetical protein PRUPE_ppa027136mg, partial [Prunus persica] Length = 783 Score = 76.6 bits (187), Expect = 3e-12 Identities = 35/60 (58%), Positives = 48/60 (80%) Frame = +2 Query: 71 SQIFSLLSSPNWQKNPSLRKLIPFIEPSHLSSLFSFNLDPQIALTFFNWIPQQKSGFKHN 250 S++F++LSSP WQK+PSL KL+P I PSH+SSLF+ LDP+IA+ FF WI + + FKH+ Sbjct: 42 SELFAVLSSPKWQKHPSLGKLMPSISPSHVSSLFALKLDPKIAIDFFCWIARTRR-FKHS 100 >ref|XP_007140312.1| hypothetical protein PHAVU_008G101600g [Phaseolus vulgaris] gi|561013445|gb|ESW12306.1| hypothetical protein PHAVU_008G101600g [Phaseolus vulgaris] Length = 896 Score = 73.9 bits (180), Expect = 2e-11 Identities = 35/65 (53%), Positives = 42/65 (64%) Frame = +2 Query: 53 PEPVHPSQIFSLLSSPNWQKNPSLRKLIPFIEPSHLSSLFSFNLDPQIALTFFNWIPQQK 232 P P PS +F+LLS PNW +PSL L+PFI P H+SSL PQ AL FFNW+ K Sbjct: 29 PPPDLPSHLFTLLSHPNWHHHPSLPHLLPFITPFHVSSLLHLKPSPQTALQFFNWV-ATK 87 Query: 233 SGFKH 247 G+KH Sbjct: 88 PGYKH 92 >ref|XP_006381417.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|550336120|gb|ERP59214.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 726 Score = 72.4 bits (176), Expect = 6e-11 Identities = 37/81 (45%), Positives = 54/81 (66%), Gaps = 2/81 (2%) Frame = +2 Query: 20 LSSNPMLPNGEPEPVHPSQIFSLLSSPNWQKNPSLRKLIPFIEPSHLSSLFSF--NLDPQ 193 ++S P+ P+ P+ + S+LS P WQ++PS +KLIP + PSH+SSLF+ +L+P Sbjct: 42 IASLPVEPD-PPDDLSSHHFLSILSHPKWQRHPSFQKLIPNLSPSHVSSLFNNHPDLNPN 100 Query: 194 IALTFFNWIPQQKSGFKHNAE 256 IAL FFN +P K GFKH + Sbjct: 101 IALQFFNSLPLIKPGFKHTVK 121 >ref|NP_201359.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75180383|sp|Q9LSL9.1|PP445_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At5g65560 gi|8978284|dbj|BAA98175.1| unnamed protein product [Arabidopsis thaliana] gi|110737310|dbj|BAF00601.1| hypothetical protein [Arabidopsis thaliana] gi|332010688|gb|AED98071.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 915 Score = 71.6 bits (174), Expect = 1e-10 Identities = 37/79 (46%), Positives = 52/79 (65%), Gaps = 1/79 (1%) Frame = +2 Query: 17 PLSSNPMLPNGEPEPVH-PSQIFSLLSSPNWQKNPSLRKLIPFIEPSHLSSLFSFNLDPQ 193 PL N LP E + + P ++ S+LS PNW K+PSL+ ++ I PSH+SSLFS +LDP+ Sbjct: 47 PLLRN--LPEEESDSMSVPHRLLSILSKPNWHKSPSLKSMVSAISPSHVSSLFSLDLDPK 104 Query: 194 IALTFFNWIPQQKSGFKHN 250 AL F +WI Q +KH+ Sbjct: 105 TALNFSHWI-SQNPRYKHS 122 >ref|XP_007158351.1| hypothetical protein PHAVU_002G145400g [Phaseolus vulgaris] gi|561031766|gb|ESW30345.1| hypothetical protein PHAVU_002G145400g [Phaseolus vulgaris] Length = 904 Score = 70.1 bits (170), Expect = 3e-10 Identities = 39/80 (48%), Positives = 52/80 (65%) Frame = +2 Query: 8 DHKPLSSNPMLPNGEPEPVHPSQIFSLLSSPNWQKNPSLRKLIPFIEPSHLSSLFSFNLD 187 + K +SS+ + P+ + PSQIF +LS P W+K+PSL LIP + PS LSSLF+ N D Sbjct: 15 NRKFISSSALPPH---QTSLPSQIFLILSRPQWRKDPSLDALIPALTPSLLSSLFNLNPD 71 Query: 188 PQIALTFFNWIPQQKSGFKH 247 P AL FF WI ++K F H Sbjct: 72 PLTALNFFRWI-RRKHSFVH 90 >ref|XP_007047758.1| Pentatricopeptide repeat (PPR) superfamily protein, putative isoform 1 [Theobroma cacao] gi|590706571|ref|XP_007047759.1| Pentatricopeptide repeat (PPR) superfamily protein, putative isoform 1 [Theobroma cacao] gi|508700019|gb|EOX91915.1| Pentatricopeptide repeat (PPR) superfamily protein, putative isoform 1 [Theobroma cacao] gi|508700020|gb|EOX91916.1| Pentatricopeptide repeat (PPR) superfamily protein, putative isoform 1 [Theobroma cacao] Length = 946 Score = 69.7 bits (169), Expect = 4e-10 Identities = 44/84 (52%), Positives = 52/84 (61%), Gaps = 5/84 (5%) Frame = +2 Query: 14 KPLSSNPM-LPNGEPEPVH--PSQIFSLLSSPNWQKNPSLRKLIPFIEPSHLSSLFSF-- 178 K LSS P LP P H P + S+LS PNWQ++PSL KLIP I PSH+ SLFS Sbjct: 63 KSLSSFPSSLPLDPDPPDHDIPLLLHSILSKPNWQRHPSLPKLIPSISPSHVHSLFSLNP 122 Query: 179 NLDPQIALTFFNWIPQQKSGFKHN 250 NL P+ AL F WI +K FKH+ Sbjct: 123 NLLPKTALDFSYWI-SKKPNFKHS 145 >ref|XP_003613018.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355514353|gb|AES95976.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 894 Score = 69.7 bits (169), Expect = 4e-10 Identities = 41/79 (51%), Positives = 50/79 (63%), Gaps = 1/79 (1%) Frame = +2 Query: 14 KPLSSNPMLPNGEPEPVHPSQIFSLLSSPNWQKNPSLRKLIPFIEPSHLSSLFSF-NLDP 190 KP SS + PN + + PSQIF++L P W+KNPS LIP + P+HLSSLF+ NL P Sbjct: 27 KPFSS--LSPNSLQQDL-PSQIFTILLQPQWRKNPSFNTLIPSLTPTHLSSLFNNPNLHP 83 Query: 191 QIALTFFNWIPQQKSGFKH 247 AL FF WI Q GF H Sbjct: 84 LTALNFFKWIHYQ-HGFIH 101 >ref|XP_003533421.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like isoform X1 [Glycine max] gi|571478486|ref|XP_006587579.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like isoform X2 [Glycine max] gi|571478488|ref|XP_006587580.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like isoform X3 [Glycine max] Length = 892 Score = 67.8 bits (164), Expect = 1e-09 Identities = 32/61 (52%), Positives = 43/61 (70%) Frame = +2 Query: 68 PSQIFSLLSSPNWQKNPSLRKLIPFIEPSHLSSLFSFNLDPQIALTFFNWIPQQKSGFKH 247 P+QIF++LS P W+K+PSL+ LIP + PS L SLF+ N DP AL FF WI ++ F H Sbjct: 26 PTQIFTILSRPRWRKDPSLKTLIPSLTPSLLCSLFNLNPDPLTALNFFRWI-RRHHNFPH 84 Query: 248 N 250 + Sbjct: 85 S 85