BLASTX nr result
ID: Paeonia22_contig00045454
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00045454 (364 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007213256.1| hypothetical protein PRUPE_ppb020741mg [Prun... 53 6e-09 >ref|XP_007213256.1| hypothetical protein PRUPE_ppb020741mg [Prunus persica] gi|462409121|gb|EMJ14455.1| hypothetical protein PRUPE_ppb020741mg [Prunus persica] Length = 707 Score = 52.8 bits (125), Expect(2) = 6e-09 Identities = 28/66 (42%), Positives = 36/66 (54%) Frame = +1 Query: 28 GIIDSSFTNDILDTKWPPKFKTPVLPIKKGATNPKSHISTYKVSMSITRVSEAIICLAFP 207 GI S FT DIL K P KF P + +G T+P HI ++ M + EA++C FP Sbjct: 222 GICKSPFTEDILKAKKPVKFTQPKFKLFEGTTDPIEHIYHFQQQMVLEGDDEALLCKLFP 281 Query: 208 SSLRPS 225 SSL S Sbjct: 282 SSLSGS 287 Score = 33.1 bits (74), Expect(2) = 6e-09 Identities = 16/35 (45%), Positives = 19/35 (54%) Frame = +3 Query: 210 FPSTLQEGTLNWFNDLETGSISIFILLSEKFLEHY 314 FPS+L L WF L+ SI F LSE F+ Y Sbjct: 280 FPSSLSGSALIWFTQLKPRSIGGFTQLSEMFISQY 314