BLASTX nr result
ID: Paeonia22_contig00044966
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00044966 (320 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006828672.1| hypothetical protein AMTR_s04653p00000520, p... 55 8e-06 >ref|XP_006828672.1| hypothetical protein AMTR_s04653p00000520, partial [Amborella trichopoda] gi|548833479|gb|ERM96088.1| hypothetical protein AMTR_s04653p00000520, partial [Amborella trichopoda] Length = 563 Score = 55.5 bits (132), Expect = 8e-06 Identities = 23/42 (54%), Positives = 30/42 (71%) Frame = +3 Query: 15 EREPFFEKPRPMLGDSKKRN*KKFCKYHKDQGHETDKCWALR 140 ER F+KP P+ G+ +R+ KKFCKYHKD GH T +CW L+ Sbjct: 123 ERNGVFKKPPPIRGNRDRRDPKKFCKYHKDIGHTTLECWVLQ 164